← Short.io + DigitalRiver integrations

Update Customer Information with DigitalRiver API on New Link Created from Short.io API

Pipedream makes it easy to connect APIs for DigitalRiver, Short.io and 2,800+ other apps remarkably fast.

Trigger workflow on
New Link Created from the Short.io API
Next, do this
Update Customer Information with the DigitalRiver API
No credit card required
Intro to Pipedream
Watch us build a workflow
Watch us build a workflow
8 min
Watch now ➜

Trusted by 1,000,000+ developers from startups to Fortune 500 companies

Adyen logo
Appcues logo
Bandwidth logo
Checkr logo
ChartMogul logo
Dataminr logo
Gopuff logo
Gorgias logo
LinkedIn logo
Logitech logo
Replicated logo
Rudderstack logo
SAS logo
Scale AI logo
Webflow logo
Warner Bros. logo
Adyen logo
Appcues logo
Bandwidth logo
Checkr logo
ChartMogul logo
Dataminr logo
Gopuff logo
Gorgias logo
LinkedIn logo
Logitech logo
Replicated logo
Rudderstack logo
SAS logo
Scale AI logo
Webflow logo
Warner Bros. logo

Developers Pipedream

Getting Started

This integration creates a workflow with a Short.io trigger and DigitalRiver action. When you configure and deploy the workflow, it will run on Pipedream's servers 24x7 for free.

  1. Select this integration
  2. Configure the New Link Created trigger
    1. Connect your Short.io account
    2. Configure Watching timer
    3. Select a Domain Id
  3. Configure the Update Customer Information action
    1. Connect your DigitalRiver account
    2. Select a Customer ID
    3. Optional- Configure Email
    4. Optional- Configure Shipping Address Line 1
    5. Optional- Configure Shipping Address Line 2
    6. Optional- Configure Shipping Address City
    7. Optional- Configure Shipping Address Postal Code
    8. Optional- Configure Shipping Address State
    9. Optional- Select a Shipping Address Country
    10. Optional- Configure Shipping Name
    11. Optional- Configure Shipping Phone
    12. Optional- Configure Shipping Email
    13. Optional- Configure Shipping Organization
    14. Optional- Configure Shipping Neighborhood
    15. Optional- Configure Shipping Division
    16. Optional- Configure Shipping Phonetic Name
    17. Optional- Configure Tax Certificate Company Name
    18. Optional- Configure Tax Certificate Autority
    19. Optional- Configure Tax Certificate Start Date
    20. Optional- Configure Tax Certificate End Date
    21. Optional- Select a Tax Certificate File Id
    22. Optional- Configure Request To Be Forgotten
    23. Optional- Select a Type
    24. Optional- Configure Metadata
    25. Optional- Configure Locale
    26. Optional- Configure Enabled
  4. Deploy the workflow
  5. Send a test event to validate your setup
  6. Turn on the trigger

Details

This integration uses pre-built, source-available components from Pipedream's GitHub repo. These components are developed by Pipedream and the community, and verified and maintained by Pipedream.

To contribute an update to an existing component or create a new component, create a PR on GitHub. If you're new to Pipedream component development, you can start with quickstarts for trigger span and action development, and then review the component API reference.

Trigger

Description:Emit new event when a link is created.
Version:0.0.4
Key:short-new-link-created

Short.io Overview

Short.io provides a robust API for URL shortening, allowing you to create, delete, and track shortened links programmatically. By integrating with Pipedream, you can automate link creation or aggregation of click data in real-time, triggering workflows in response to events like link clicks or creating short links in bulk from a data source.

Trigger Code

import shortApp from "../../short.app.mjs";
import { DEFAULT_POLLING_SOURCE_TIMER_INTERVAL } from "@pipedream/platform";

export default {
  key: "short-new-link-created",
  name: "New Link Created",
  description: "Emit new event when a link is created.",
  version: "0.0.4",
  type: "source",
  dedupe: "unique",
  props: {
    shortApp,
    timer: {
      type: "$.interface.timer",
      label: "Watching timer",
      description: "How often to watch the links.",
      default: {
        intervalSeconds: DEFAULT_POLLING_SOURCE_TIMER_INTERVAL,
      },
    },
    domainId: {
      propDefinition: [
        shortApp,
        "domainId",
      ],
    },
  },
  methods: {
    emit(meta) {
      const ts = Date.parse(meta.createdAt);
      this.$emit(meta, {
        id: meta.idString,
        summary: meta.secureShortURL,
        ts,
      });
    },
  },
  async run() {
    const links = await this.shortApp.listLinks(this.domainId);
    for (const link of links) {
      this.emit(link);
    }
  },
};

Trigger Configuration

This component may be configured based on the props defined in the component code. Pipedream automatically prompts for input values in the UI and CLI.
LabelPropTypeDescription
Short.ioshortAppappThis component uses the Short.io app.
Watching timertimer$.interface.timer

How often to watch the links.

Domain IddomainIdintegerSelect a value from the drop down menu.

Trigger Authentication

Short.io uses API keys for authentication. When you connect your Short.io account, Pipedream securely stores the keys so you can easily authenticate to Short.io APIs in both code and no-code steps.

Get your secret key here

About Short.io

White label URL Shortener

Action

Description:Updates the information for a customer in Digital River. [See the documentation](https://www.digitalriver.com/docs/digital-river-api-reference/#tag/Customers/operation/updateCustomers)
Version:0.0.1
Key:digitalriver-update-customer-information

DigitalRiver Overview

The DigitalRiver API lets you manage e-commerce activities like orders, payments, and customer information. On Pipedream, you can harness this API to create automated workflows that integrate with other apps, react to events, process transactions, and handle global e-commerce complexities. Pipedream's serverless platform enables you to build and execute these workflows quickly, without setting up infrastructure, and to connect DigitalRiver with countless other services for a seamless e-commerce ecosystem.

Action Code

import { COUNTRY_OPTIONS } from "../../common/constants.mjs";
import { clearObj } from "../../common/utils.mjs";
import digitalriver from "../../digitalriver.app.mjs";

export default {
  key: "digitalriver-update-customer-information",
  name: "Update Customer Information",
  description: "Updates the information for a customer in Digital River. [See the documentation](https://www.digitalriver.com/docs/digital-river-api-reference/#tag/Customers/operation/updateCustomers)",
  version: "0.0.1",
  type: "action",
  props: {
    digitalriver,
    customerId: {
      propDefinition: [
        digitalriver,
        "customerId",
      ],
    },
    email: {
      type: "string",
      label: "Email",
      description: "The customer email address.",
      optional: true,
    },
    line1: {
      type: "string",
      label: "Shipping Address Line 1",
      description: "The first line of the address.",
      optional: true,
    },
    line2: {
      type: "string",
      label: "Shipping Address Line 2",
      description: "The second line of the address.",
      optional: true,
    },
    city: {
      type: "string",
      label: "Shipping Address City",
      description: "The city of the address.",
      optional: true,
    },
    postalCode: {
      type: "string",
      label: "Shipping Address Postal Code",
      description: "The postal code of the address.",
      optional: true,
    },
    state: {
      type: "string",
      label: "Shipping Address State",
      description: "The state, county, province, or region.",
      optional: true,
    },
    country: {
      type: "string",
      label: "Shipping Address Country",
      description: "A [two-letter Alpha-2 country code](https://www.iban.com/country-codes) as described in the [ISO 3166](https://www.iso.org/iso-3166-country-codes.html) international standard.",
      options: COUNTRY_OPTIONS,
      optional: true,
    },
    name: {
      type: "string",
      label: "Shipping Name",
      description: "The recipient's name.",
      optional: true,
    },
    phone: {
      type: "string",
      label: "Shipping Phone",
      description: "The recipient's phone number.",
      optional: true,
    },
    shippingEmail: {
      type: "string",
      label: "Shipping Email",
      description: "The recipient's email address.",
      optional: true,
    },
    organization: {
      type: "string",
      label: "Shipping Organization",
      description: "The recipient's organization.",
      optional: true,
    },
    neighborhood: {
      type: "string",
      label: "Shipping Neighborhood",
      description: "The neighborhood of the address.",
      optional: true,
    },
    division: {
      type: "string",
      label: "Shipping Division",
      description: "A division within an organization.",
      optional: true,
    },
    phoneticName: {
      type: "string",
      label: "Shipping Phonetic Name",
      description: "The phonetic spelling of a name.",
      optional: true,
    },
    companyName: {
      type: "string",
      label: "Tax Certificate Company Name",
      description: "The name of the company that holds the certificate.",
      optional: true,
    },
    taxAuthority: {
      type: "string",
      label: "Tax Certificate Autority",
      description: "The issuing state.",
      optional: true,
    },
    startDate: {
      type: "string",
      label: "Tax Certificate Start Date",
      description: "Tax certificate start date.",
      optional: true,
    },
    endDate: {
      type: "string",
      label: "Tax Certificate End Date",
      description: "Tax certificate end date.",
      optional: true,
    },
    fileId: {
      propDefinition: [
        digitalriver,
        "fileId",
      ],
      label: "Tax Certificate File Id",
      description: "The identifier of the file that contains the tax certificate.",
      optional: true,
    },
    requestToBeForgotten: {
      type: "boolean",
      label: "Request To Be Forgotten",
      description: "If `true`, indicates this customer has submitted a request to be forgotten.",
      optional: true,
    },
    type: {
      type: "string",
      label: "Type",
      description: "The type of customer.",
      options: [
        "business",
        "individual",
      ],
      optional: true,
    },
    metadata: {
      propDefinition: [
        digitalriver,
        "metadata",
      ],
      optional: true,
    },
    locale: {
      type: "string",
      label: "Locale",
      description: "A locale designator that combines the two-letter ISO 639-1 language code with the ISO 3166-1 alpha-2 country code.",
      optional: true,
    },
    enabled: {
      type: "boolean",
      label: "Enabled",
      description: "Usually used to disable the customer. The default is true. If false, attempts to create orders for the customer will fail.",
      optional: true,
    },
  },
  async run({ $ }) {
    const {
      digitalriver,
      customerId,
      line1,
      line2,
      city,
      postalCode,
      state,
      country,
      name,
      phone,
      shippingEmail,
      organization,
      neighborhood,
      division,
      phoneticName,
      companyName,
      taxAuthority,
      startDate,
      endDate,
      fileId,
      ...data
    } = this;

    const response = await digitalriver.updateCustomer({
      $,
      customerId,
      data: clearObj({
        ...data,
        shipping: {
          address: {
            line1,
            line2,
            city,
            postalCode,
            state,
            country,
          },
          name,
          phone,
          email: shippingEmail,
          organization,
          additionalAddressInfo: {
            neighborhood,
            division,
            phoneticName,
          },
        },
        taxCertificate: {
          companyName,
          taxAuthority,
          startDate,
          endDate,
          fileId,
        },
      }),
    });

    $.export("$summary", `Updated customer information for contact ID ${this.customerId}`);
    return response;
  },
};

Action Configuration

This component may be configured based on the props defined in the component code. Pipedream automatically prompts for input values in the UI.

LabelPropTypeDescription
DigitalRiverdigitalriverappThis component uses the DigitalRiver app.
Customer IDcustomerIdstringSelect a value from the drop down menu.
Emailemailstring

The customer email address.

Shipping Address Line 1line1string

The first line of the address.

Shipping Address Line 2line2string

The second line of the address.

Shipping Address Citycitystring

The city of the address.

Shipping Address Postal CodepostalCodestring

The postal code of the address.

Shipping Address Statestatestring

The state, county, province, or region.

Shipping Address CountrycountrystringSelect a value from the drop down menu:AFALDZASADAOAIAQAGARAMAWAUATAZBSBHBDBBBYBEBZBJBMBTBOBQBABWBVBRIOBNBGBFBICVKHCMCAKYCFTDCLCNCXCCCOKMCDCGCKCRHRCUCWCYCZCIDKDJDMDOECEGSVGQEREESZETFKFOFJFIFRGFPFTFGAGMGEDEGHGIGRGLGDGPGUGTGGGNGWGYHTHMVAHNHKHUISINIDIRIQIEIMILITJMJPJEJOKZKEKIKPKRKWKGLALVLBLSLRLYLILTLUMOMGMWMYMVMLMTMHMQMRMUYTMXFMMDMCMNMEMSMAMZMMNANRNPNLNCNZNINENGNUNFMPNOOMPKPWPSPAPGPYPEPHPNPLPTPRQAMKRORURWREBLSHKNLCMFPMVCWSSMSTSASNRSSCSLSGSXSKSISBSOZAGSSSESLKSDSRSJSECHSYTWTJTZTHTLTGTKTOTTTNTRTMTCTVUGUAAEGBUMUSUYUZVUVEVNVGVIWFEHYEZMZWAX
Shipping Namenamestring

The recipient's name.

Shipping Phonephonestring

The recipient's phone number.

Shipping EmailshippingEmailstring

The recipient's email address.

Shipping Organizationorganizationstring

The recipient's organization.

Shipping Neighborhoodneighborhoodstring

The neighborhood of the address.

Shipping Divisiondivisionstring

A division within an organization.

Shipping Phonetic NamephoneticNamestring

The phonetic spelling of a name.

Tax Certificate Company NamecompanyNamestring

The name of the company that holds the certificate.

Tax Certificate AutoritytaxAuthoritystring

The issuing state.

Tax Certificate Start DatestartDatestring

Tax certificate start date.

Tax Certificate End DateendDatestring

Tax certificate end date.

Tax Certificate File IdfileIdstringSelect a value from the drop down menu.
Request To Be ForgottenrequestToBeForgottenboolean

If true, indicates this customer has submitted a request to be forgotten.

TypetypestringSelect a value from the drop down menu:businessindividual
Metadatametadataobject

Key-value pairs used to store additional data. Value can be string, boolean or integer types.

Localelocalestring

A locale designator that combines the two-letter ISO 639-1 language code with the ISO 3166-1 alpha-2 country code.

Enabledenabledboolean

Usually used to disable the customer. The default is true. If false, attempts to create orders for the customer will fail.

Action Authentication

DigitalRiver uses API keys for authentication. When you connect your DigitalRiver account, Pipedream securely stores the keys so you can easily authenticate to DigitalRiver APIs in both code and no-code steps.

Sign in and copy your API key from your Dashboard under API Keys

About DigitalRiver

The ultimate ecommerce accelerator for global growth. Fast, easy, risk-free expansion into 240+ destinations. Accelerate. Simplify. Optimize.

More Ways to Connect DigitalRiver + Short.io

Cancel Order with DigitalRiver API on New event for each link created. from Short.io API
Short.io + DigitalRiver
 
Try it
Create a Product with DigitalRiver API on New event for each link created. from Short.io API
Short.io + DigitalRiver
 
Try it
Create a Short Link with Short.io API on New Payment Status Updated (Instant) from DigitalRiver API
DigitalRiver + Short.io
 
Try it
Delete a Short Link with Short.io API on New Payment Status Updated (Instant) from DigitalRiver API
DigitalRiver + Short.io
 
Try it
Domain Statistics. with Short.io API on New Payment Status Updated (Instant) from DigitalRiver API
DigitalRiver + Short.io
 
Try it
New Link Created from the Short.io API

Emit new event when a link is created.

 
Try it
New Order Completed (Instant) from the DigitalRiver API

Emit new event when a customer successfully completes an order.

 
Try it
New Payment Status Updated (Instant) from the DigitalRiver API

Emit new event each time the payment status of an order is updated in Digital River.

 
Try it
Create Link with the Short.io API

Create a Short Link. See the documentation

 
Try it
Delete Link with the Short.io API

Delete a Short Link. See the documentation

 
Try it
Expire Link with the Short.io API

Expire a short link by id. See the documentation

 
Try it
Get Domain Statistics with the Short.io API

Returns detailed statistics for a domain in given period. See the documentation

 
Try it
Update Link with the Short.io API

Update original URL, title or path for existing URL by id. See the documentation

 
Try it

Explore Other Apps

1
-
24
of
2,800+
apps by most popular

HTTP / Webhook
HTTP / Webhook
Get a unique URL where you can send HTTP or webhook requests
Node
Node
Anything you can do with Node.js, you can do in a Pipedream workflow. This includes using most of npm's 400,000+ packages.
Python
Python
Anything you can do in Python can be done in a Pipedream Workflow. This includes using any of the 350,000+ PyPi packages available in your Python powered workflows.
Schedule
Schedule
Trigger workflows on an interval or cron schedule.
Pipedream Utils
Pipedream Utils
Utility functions to use within your Pipedream workflows
Notion
Notion
Notion is a new tool that blends your everyday work apps into one. It's the all-in-one workspace for you and your team.
OpenAI (ChatGPT)
OpenAI (ChatGPT)
OpenAI is an AI research and deployment company with the mission to ensure that artificial general intelligence benefits all of humanity. They are the makers of popular models like ChatGPT, DALL-E, and Whisper.
Anthropic (Claude)
Anthropic (Claude)
AI research and products that put safety at the frontier. Introducing Claude, a next-generation AI assistant for your tasks, no matter the scale.
Google Sheets
Google Sheets
Use Google Sheets to create and edit online spreadsheets. Get insights together with secure sharing in real-time and from any device.
Telegram
Telegram
Telegram, is a cloud-based, cross-platform, encrypted instant messaging (IM) service.
Google Drive
Google Drive
Google Drive is a file storage and synchronization service which allows you to create and share your work online, and access your documents from anywhere.
Google Calendar
Google Calendar
With Google Calendar, you can quickly schedule meetings and events and get reminders about upcoming activities, so you always know what’s next.
Shopify
Shopify
Shopify is a complete commerce platform that lets anyone start, manage, and grow a business. You can use Shopify to build an online store, manage sales, market to customers, and accept payments in digital and physical locations.
Supabase
Supabase
Supabase is an open source Firebase alternative.
MySQL
MySQL
MySQL is an open-source relational database management system.
PostgreSQL
PostgreSQL
PostgreSQL is a free and open-source relational database management system emphasizing extensibility and SQL compliance.
Premium
AWS
AWS
Amazon Web Services (AWS) offers reliable, scalable, and inexpensive cloud computing services.
Premium
Twilio SendGrid
Twilio SendGrid
Send marketing and transactional email through the Twilio SendGrid platform with the Email API, proprietary mail transfer agent, and infrastructure for scalable delivery.
Amazon SES
Amazon SES
Amazon SES is a cloud-based email service provider that can integrate into any application for high volume email automation
Premium
Klaviyo
Klaviyo
Email Marketing and SMS Marketing Platform
Premium
Zendesk
Zendesk
Zendesk is award-winning customer service software trusted by 200K+ customers. Make customers happy via text, mobile, phone, email, live chat, social media.
Premium
ServiceNow
ServiceNow
The smarter way to workflow
Slack
Slack
Slack is a channel-based messaging platform. With Slack, people can work together more effectively, connect all their software tools and services, and find the information they need to do their best work — all within a secure, enterprise-grade environment.
Microsoft Teams
Microsoft Teams
Microsoft Teams has communities, events, chats, channels, meetings, storage, tasks, and calendars in one place.