← Cloze + Pipefy integrations

Create Pipe with Pipefy API on Company Change (Instant) from Cloze API

Pipedream makes it easy to connect APIs for Pipefy, Cloze and 2,500+ other apps remarkably fast.

Trigger workflow on
Company Change (Instant) from the Cloze API
Next, do this
Create Pipe with the Pipefy API
No credit card required
Intro to Pipedream
Watch us build a workflow
Watch us build a workflow
8 min
Watch now ➜

Trusted by 1,000,000+ developers from startups to Fortune 500 companies

Adyen logo
Appcues logo
Bandwidth logo
Checkr logo
ChartMogul logo
Dataminr logo
Gopuff logo
Gorgias logo
LinkedIn logo
Logitech logo
Replicated logo
Rudderstack logo
SAS logo
Scale AI logo
Webflow logo
Warner Bros. logo
Adyen logo
Appcues logo
Bandwidth logo
Checkr logo
ChartMogul logo
Dataminr logo
Gopuff logo
Gorgias logo
LinkedIn logo
Logitech logo
Replicated logo
Rudderstack logo
SAS logo
Scale AI logo
Webflow logo
Warner Bros. logo

Developers Pipedream

Getting Started

This integration creates a workflow with a Cloze trigger and Pipefy action. When you configure and deploy the workflow, it will run on Pipedream's servers 24x7 for free.

  1. Select this integration
  2. Configure the Company Change (Instant) trigger
    1. Connect your Cloze account
    2. Select a Scope
  3. Configure the Create Pipe action
    1. Connect your Pipefy account
    2. Select a Organization
    3. Configure Name
    4. Configure Phase Names
    5. Optional- Select one or more Members
    6. Optional- Select a Icon
  4. Deploy the workflow
  5. Send a test event to validate your setup
  6. Turn on the trigger

Details

This integration uses pre-built, source-available components from Pipedream's GitHub repo. These components are developed by Pipedream and the community, and verified and maintained by Pipedream.

To contribute an update to an existing component or create a new component, create a PR on GitHub. If you're new to Pipedream component development, you can start with quickstarts for trigger span and action development, and then review the component API reference.

Trigger

Description:Emit new event when significant changes regarding a company are detected. [See the documentation](https://api.cloze.com/api-docs/#!/Webhooks/post_v1_subscribe).
Version:0.0.1
Key:cloze-company-change-instant

Cloze Overview

The Cloze API enables you to access and manage your Cloze CRM data programmatically. In Pipedream, you can create powerful, serverless workflows that react to events or run on schedules to automate tasks involving Cloze data. You could synchronize contacts, track communication history, or trigger actions based on updates in Cloze. By leveraging Pipedream's capacity to connect to a myriad of services, you can create multi-step workflows that involve other apps to streamline your business processes and harness the full potential of CRM automation.

Trigger Code

import common from "../common/webhook.mjs";
import events from "../common/events.mjs";
import sampleEmit from "./test-event.mjs";

export default {
  ...common,
  key: "cloze-company-change-instant",
  name: "Company Change (Instant)",
  description: "Emit new event when significant changes regarding a company are detected. [See the documentation](https://api.cloze.com/api-docs/#!/Webhooks/post_v1_subscribe).",
  version: "0.0.1",
  type: "source",
  dedupe: "unique",
  methods: {
    ...common.methods,
    getEventName() {
      return events.COMPANY_CHANGE;
    },
    generateMeta(event) {
      return {
        id: event?.company.syncKey,
        summary: "New Company Change",
        ts: event?.company.lastChanged,
      };
    },
  },
  sampleEmit,
};

Trigger Configuration

This component may be configured based on the props defined in the component code. Pipedream automatically prompts for input values in the UI and CLI.
LabelPropTypeDescription
ClozeappappThis component uses the Cloze app.
N/Adb$.service.dbThis component uses $.service.db to maintain state between executions.
N/Ahttp$.interface.httpThis component uses $.interface.http to generate a unique URL when the component is first instantiated. Each request to the URL will trigger the run() method of the component.
ScopescopestringSelect a value from the drop down menu:localteam

Trigger Authentication

Cloze uses OAuth authentication. When you connect your Cloze account, Pipedream will open a popup window where you can sign into Cloze and grant Pipedream permission to connect to your account. Pipedream securely stores and automatically refreshes the OAuth tokens so you can easily authenticate any Cloze API.

Pipedream requests the following authorization scopes when you connect your account:

About Cloze

Cloze automatically keeps track of your email, phone calls, text messages, meetings, documents, Evernote, LinkedIn, Facebook, and Twitter.

Action

Description:Creates a pipe. [See the docs here](https://api-docs.pipefy.com/reference/mutations/createPipe/)
Version:0.3.2
Key:pipefy-create-pipe

Pipefy Overview

Pipefy is a platform that empowers users to streamline complex processes and workflows without the need for technical skills. With the Pipefy API, you can automate various aspects of your Pipefy environment, such as creating cards, updating fields, and managing pipelines programmatically. Use Pipedream to connect Pipefy with hundreds of other apps and orchestrate workflows that can save time, reduce errors, and enhance efficiency.

Action Code

import pipefy from "../../pipefy.app.mjs";
import constants from "../common/constants.mjs";

export default {
  key: "pipefy-create-pipe",
  name: "Create Pipe",
  description: "Creates a pipe. [See the docs here](https://api-docs.pipefy.com/reference/mutations/createPipe/)",
  version: "0.3.2",
  type: "action",
  props: {
    pipefy,
    organization: {
      propDefinition: [
        pipefy,
        "organization",
      ],
    },
    name: {
      type: "string",
      label: "Name",
      description: "Name of the new Pipe",
    },
    phases: {
      type: "string[]",
      label: "Phase Names",
      description: "Names of the new Pipe's phases",
      reloadProps: true,
    },
    members: {
      propDefinition: [
        pipefy,
        "members",
        (c) => ({
          orgId: c.organization,
        }),
      ],
      withLabel: true,
      reloadProps: true,
    },
    icon: {
      type: "string",
      label: "Icon",
      description: "The Pipe icon",
      options: constants.ICON_OPTIONS,
      optional: true,
    },
  },
  async additionalProps() {
    const props = {};
    if (this.phases?.length > 0) {
      for (const phase of this.phases) {
        props[phase] = {
          type: "boolean",
          label: `${phase} Done?`,
          description: `Is ${phase} a final/done phase?`,
          default: false,
        };
      }
    }
    if (this.members?.length > 0) {
      for (const member of this.members) {
        props[member.value] = {
          type: "string",
          label: `Role for ${member.label}`,
          description: "The user role name",
          options: constants.ROLE_OPTIONS,
        };
      }
    }
    return props;
  },
  async run({ $ }) {
  /*
  Example query:

  mutation createNewPipe{
    createPipe(
        input: {name: "UsersPipe", organization_id: 300455771 } ) {
            pipe{id name}
      }
  }
  */

    const variables = {
      name: this.name,
      organizationId: this.organization,
      icon: this.icon,
    };

    if (this.phases?.length > 0) {
      const phases = [];
      for (const phase of this.phases) {
        phases.push({
          name: phase,
          done: this[phase],
        });
      }
      variables.phases = phases;
    }

    if (this.members?.length > 0) {
      const members = [];
      for (const member of this.members) {
        members.push({
          role_name: this[member.value],
          user_id: member.value,
        });
      }
      variables.members = members;
    }

    const response = await this.pipefy.createPipe(variables);
    $.export("$summary", "Successfully created pipe");
    return response;
  },
};

Action Configuration

This component may be configured based on the props defined in the component code. Pipedream automatically prompts for input values in the UI.

LabelPropTypeDescription
PipefypipefyappThis component uses the Pipefy app.
OrganizationorganizationstringSelect a value from the drop down menu.
Namenamestring

Name of the new Pipe

Phase Namesphasesstring[]

Names of the new Pipe's phases

Membersmembersstring[]Select a value from the drop down menu.
IconiconstringSelect a value from the drop down menu:airplaneataxebadgebagboatbriefingbugbullhorncalendarcartcatchart-zoomchart2chatcheckchecklistcompasscontractdogeiffelemofinish-flagflameframefroggamegithubglobegrowthhr-processhr-requestsicejuicelamplemonadelibertylikemacmagicmapmessagemkt-requestsmoneyonboardingpacmanpacman1payablephonepipefypizzaplanetplugreceivablesreceiverecruitment-requestsreloadrocketsalesskullsnow-flakestartargettasktask-managementtrophyunderwear

Action Authentication

Pipefy uses API keys for authentication. When you connect your Pipefy account, Pipedream securely stores the keys so you can easily authenticate to Pipefy APIs in both code and no-code steps.

To authorize requests to the Pipefy API, you'll need to generate a Personal access token. In order to create Pipefy triggers in Pipedream, you will need to be a Pipefy administrator.

About Pipefy

Process Management, Workflow Management Software

More Ways to Connect Pipefy + Cloze

Create Or Update Project with Cloze API on Card Created (Instant) from Pipefy API
Pipefy + Cloze
 
Try it
Create Or Update Project with Cloze API on Card Done (Instant) from Pipefy API
Pipefy + Cloze
 
Try it
Create Or Update Project with Cloze API on Card Field Updated (Instant) from Pipefy API
Pipefy + Cloze
 
Try it
Create Or Update Project with Cloze API on Card Moved (Instant) from Pipefy API
Pipefy + Cloze
 
Try it
Create Or Update Project with Cloze API on Card Expired from Pipefy API
Pipefy + Cloze
 
Try it
Company Change (Instant) from the Cloze API

Emit new event when significant changes regarding a company are detected. See the documentation

 
Try it
Person Change (Instant) from the Cloze API

Emit new event when significant changes happen to a person. See the documentation

 
Try it
Project Change (Instant) from the Cloze API

Emit new event when a significant change occurs in a project. See the documentation

 
Try it
Card Created (Instant) from the Pipefy API

Emits an event for each new card created in a Pipe.

 
Try it
Card Done (Instant) from the Pipefy API

Emits an event each time a card is moved to Done a Pipe.

 
Try it
Create Note with the Cloze API

Creates a note in Cloze. See the documentation

 
Try it
Create Or Update Company with the Cloze API

Create a new company or enhance an existing company within Cloze. Companies can be created with just a domain name or both a name and another unique identifier such as a phone number and email address. See the documentation

 
Try it
Create Or Update Project with the Cloze API

Create a new project or merge updates into an existing one. See the documentation

 
Try it
Create Card with the Pipefy API

Create a new Card in a Pipe. See the docs here

 
Try it
Create Pipe with the Pipefy API

Creates a pipe. See the docs here

 
Try it

Explore Other Apps

1
-
24
of
2,500+
apps by most popular

HTTP / Webhook
HTTP / Webhook
Get a unique URL where you can send HTTP or webhook requests
Node
Node
Anything you can do with Node.js, you can do in a Pipedream workflow. This includes using most of npm's 400,000+ packages.
Python
Python
Anything you can do in Python can be done in a Pipedream Workflow. This includes using any of the 350,000+ PyPi packages available in your Python powered workflows.
Pipedream Utils
Pipedream Utils
Utility functions to use within your Pipedream workflows
OpenAI (ChatGPT)
OpenAI (ChatGPT)
OpenAI is an AI research and deployment company with the mission to ensure that artificial general intelligence benefits all of humanity. They are the makers of popular models like ChatGPT, DALL-E, and Whisper.
Premium
Salesforce
Salesforce
Cloud-based customer relationship management (CRM) platform that helps businesses manage sales, marketing, customer support, and other business activities, ultimately aiming to improve customer relationships and streamline operations.
Premium
HubSpot
HubSpot
HubSpot's CRM platform contains the marketing, sales, service, operations, and website-building software you need to grow your business.
Premium
Zoho CRM
Zoho CRM
Zoho CRM is an online Sales CRM software that manages your sales, marketing, and support in one CRM platform.
Premium
Stripe
Stripe
Stripe powers online and in-person payment processing and financial solutions for businesses of all sizes.
Shopify
Shopify
Shopify is a complete commerce platform that lets anyone start, manage, and grow a business. You can use Shopify to build an online store, manage sales, market to customers, and accept payments in digital and physical locations.
Premium
WooCommerce
WooCommerce
WooCommerce is the open-source ecommerce platform for WordPress.
Premium
Snowflake
Snowflake
A data warehouse built for the cloud
Premium
MongoDB
MongoDB
MongoDB is an open source NoSQL database management program.
Supabase
Supabase
Supabase is an open source Firebase alternative.
MySQL
MySQL
MySQL is an open-source relational database management system.
PostgreSQL
PostgreSQL
PostgreSQL is a free and open-source relational database management system emphasizing extensibility and SQL compliance.
Premium
AWS
AWS
Amazon Web Services (AWS) offers reliable, scalable, and inexpensive cloud computing services.
Premium
Twilio SendGrid
Twilio SendGrid
Send marketing and transactional email through the Twilio SendGrid platform with the Email API, proprietary mail transfer agent, and infrastructure for scalable delivery.
Amazon SES
Amazon SES
Amazon SES is a cloud-based email service provider that can integrate into any application for high volume email automation
Premium
Klaviyo
Klaviyo
Email Marketing and SMS Marketing Platform
Premium
Zendesk
Zendesk
Zendesk is award-winning customer service software trusted by 200K+ customers. Make customers happy via text, mobile, phone, email, live chat, social media.
Premium
ServiceNow
ServiceNow
The smarter way to workflow
Notion
Notion
Notion is a new tool that blends your everyday work apps into one. It's the all-in-one workspace for you and your team.
Slack
Slack
Slack is a channel-based messaging platform. With Slack, people can work together more effectively, connect all their software tools and services, and find the information they need to do their best work — all within a secure, enterprise-grade environment.