← Ragic + Pipefy integrations

Create Pipe with Pipefy API on New Created Record (Instant) from Ragic API

Pipedream makes it easy to connect APIs for Pipefy, Ragic and 2,700+ other apps remarkably fast.

Trigger workflow on
New Created Record (Instant) from the Ragic API
Next, do this
Create Pipe with the Pipefy API
No credit card required
Intro to Pipedream
Watch us build a workflow
Watch us build a workflow
8 min
Watch now ➜

Trusted by 1,000,000+ developers from startups to Fortune 500 companies

Adyen logo
Appcues logo
Bandwidth logo
Checkr logo
ChartMogul logo
Dataminr logo
Gopuff logo
Gorgias logo
LinkedIn logo
Logitech logo
Replicated logo
Rudderstack logo
SAS logo
Scale AI logo
Webflow logo
Warner Bros. logo
Adyen logo
Appcues logo
Bandwidth logo
Checkr logo
ChartMogul logo
Dataminr logo
Gopuff logo
Gorgias logo
LinkedIn logo
Logitech logo
Replicated logo
Rudderstack logo
SAS logo
Scale AI logo
Webflow logo
Warner Bros. logo

Developers Pipedream

Getting Started

This integration creates a workflow with a Ragic trigger and Pipefy action. When you configure and deploy the workflow, it will run on Pipedream's servers 24x7 for free.

  1. Select this integration
  2. Configure the New Created Record (Instant) trigger
    1. Connect your Ragic account
    2. Select a Tab
    3. Select a Sheet
  3. Configure the Create Pipe action
    1. Connect your Pipefy account
    2. Select a Organization
    3. Configure Name
    4. Configure Phase Names
    5. Optional- Select one or more Members
    6. Optional- Select a Icon
  4. Deploy the workflow
  5. Send a test event to validate your setup
  6. Turn on the trigger

Details

This integration uses pre-built, source-available components from Pipedream's GitHub repo. These components are developed by Pipedream and the community, and verified and maintained by Pipedream.

To contribute an update to an existing component or create a new component, create a PR on GitHub. If you're new to Pipedream component development, you can start with quickstarts for trigger span and action development, and then review the component API reference.

Trigger

Description:Emit new event when a record is created. [Instructions on creating webhooks here](https://www.ragic.com/intl/en/doc-api/33/Webhook-on-Ragic).
Version:0.0.1
Key:ragic-record-created-instant

Ragic Overview

The Ragic API offers a robust way to interact with your Ragic databases, enabling you to create, read, update, and delete records programmatically. With its API, you can automate data entry, synchronize data across platforms, and trigger custom workflows. Pipedream amplifies these capabilities with a serverless platform where you can deploy these automations rapidly, reacting to events in Ragic or orchestrating actions across multiple apps.

Trigger Code

import base from "../common/webhooks.mjs";

const docLink = "https://www.ragic.com/intl/en/doc-api/33/Webhook-on-Ragic";

export default {
  ...base,
  key: "ragic-record-created-instant",
  name: "New Created Record (Instant)",
  description: `Emit new event when a record is created. [Instructions on creating webhooks here](${docLink}).`,
  version: "0.0.1",
  type: "source",
  methods: {
    ...base.methods,
    isRelevant(recordId) {
      if (this.isNew(recordId)) {
        this.addRecord(recordId);
        return true;
      }
    },
  },
};

Trigger Configuration

This component may be configured based on the props defined in the component code. Pipedream automatically prompts for input values in the UI and CLI.
LabelPropTypeDescription
RagicragicappThis component uses the Ragic app.
N/Ahttp$.interface.httpThis component uses $.interface.http to generate a unique URL when the component is first instantiated. Each request to the URL will trigger the run() method of the component.
N/Adb$.service.dbThis component uses $.service.db to maintain state between executions.
TabtabstringSelect a value from the drop down menu.
SheetsheetstringSelect a value from the drop down menu.

Trigger Authentication

Ragic uses API keys for authentication. When you connect your Ragic account, Pipedream securely stores the keys so you can easily authenticate to Ragic APIs in both code and no-code steps.

  • You can get your API Key on your Home menu on the top right then Personal Settings > Profile.
  • Your database is 12345678 if your Ragic URL is https://www.ragic.com/1234567
  • Your domain is abc if your Ragic URL is https://abc.ragic.com/12345678

About Ragic

Be your own data expert! Visit www.ragic.com to get started with your free database!

Action

Description:Creates a pipe. [See the docs here](https://api-docs.pipefy.com/reference/mutations/createPipe/)
Version:0.3.2
Key:pipefy-create-pipe

Pipefy Overview

Pipefy is a platform that empowers users to streamline complex processes and workflows without the need for technical skills. With the Pipefy API, you can automate various aspects of your Pipefy environment, such as creating cards, updating fields, and managing pipelines programmatically. Use Pipedream to connect Pipefy with hundreds of other apps and orchestrate workflows that can save time, reduce errors, and enhance efficiency.

Action Code

import pipefy from "../../pipefy.app.mjs";
import constants from "../common/constants.mjs";

export default {
  key: "pipefy-create-pipe",
  name: "Create Pipe",
  description: "Creates a pipe. [See the docs here](https://api-docs.pipefy.com/reference/mutations/createPipe/)",
  version: "0.3.2",
  type: "action",
  props: {
    pipefy,
    organization: {
      propDefinition: [
        pipefy,
        "organization",
      ],
    },
    name: {
      type: "string",
      label: "Name",
      description: "Name of the new Pipe",
    },
    phases: {
      type: "string[]",
      label: "Phase Names",
      description: "Names of the new Pipe's phases",
      reloadProps: true,
    },
    members: {
      propDefinition: [
        pipefy,
        "members",
        (c) => ({
          orgId: c.organization,
        }),
      ],
      withLabel: true,
      reloadProps: true,
    },
    icon: {
      type: "string",
      label: "Icon",
      description: "The Pipe icon",
      options: constants.ICON_OPTIONS,
      optional: true,
    },
  },
  async additionalProps() {
    const props = {};
    if (this.phases?.length > 0) {
      for (const phase of this.phases) {
        props[phase] = {
          type: "boolean",
          label: `${phase} Done?`,
          description: `Is ${phase} a final/done phase?`,
          default: false,
        };
      }
    }
    if (this.members?.length > 0) {
      for (const member of this.members) {
        props[member.value] = {
          type: "string",
          label: `Role for ${member.label}`,
          description: "The user role name",
          options: constants.ROLE_OPTIONS,
        };
      }
    }
    return props;
  },
  async run({ $ }) {
  /*
  Example query:

  mutation createNewPipe{
    createPipe(
        input: {name: "UsersPipe", organization_id: 300455771 } ) {
            pipe{id name}
      }
  }
  */

    const variables = {
      name: this.name,
      organizationId: this.organization,
      icon: this.icon,
    };

    if (this.phases?.length > 0) {
      const phases = [];
      for (const phase of this.phases) {
        phases.push({
          name: phase,
          done: this[phase],
        });
      }
      variables.phases = phases;
    }

    if (this.members?.length > 0) {
      const members = [];
      for (const member of this.members) {
        members.push({
          role_name: this[member.value],
          user_id: member.value,
        });
      }
      variables.members = members;
    }

    const response = await this.pipefy.createPipe(variables);
    $.export("$summary", "Successfully created pipe");
    return response;
  },
};

Action Configuration

This component may be configured based on the props defined in the component code. Pipedream automatically prompts for input values in the UI.

LabelPropTypeDescription
PipefypipefyappThis component uses the Pipefy app.
OrganizationorganizationstringSelect a value from the drop down menu.
Namenamestring

Name of the new Pipe

Phase Namesphasesstring[]

Names of the new Pipe's phases

Membersmembersstring[]Select a value from the drop down menu.
IconiconstringSelect a value from the drop down menu:airplaneataxebadgebagboatbriefingbugbullhorncalendarcartcatchart-zoomchart2chatcheckchecklistcompasscontractdogeiffelemofinish-flagflameframefroggamegithubglobegrowthhr-processhr-requestsicejuicelamplemonadelibertylikemacmagicmapmessagemkt-requestsmoneyonboardingpacmanpacman1payablephonepipefypizzaplanetplugreceivablesreceiverecruitment-requestsreloadrocketsalesskullsnow-flakestartargettasktask-managementtrophyunderwear

Action Authentication

Pipefy uses API keys for authentication. When you connect your Pipefy account, Pipedream securely stores the keys so you can easily authenticate to Pipefy APIs in both code and no-code steps.

To authorize requests to the Pipefy API, you'll need to generate a Personal access token. In order to create Pipefy triggers in Pipedream, you will need to be a Pipefy administrator.

About Pipefy

Process Management, Workflow Management Software

More Ways to Connect Pipefy + Ragic

Create Record with Ragic API on Card Created (Instant) from Pipefy API
Pipefy + Ragic
 
Try it
Create Record with Ragic API on Card Done (Instant) from Pipefy API
Pipefy + Ragic
 
Try it
Create Record with Ragic API on Card Expired from Pipefy API
Pipefy + Ragic
 
Try it
Create Record with Ragic API on Card Field Updated (Instant) from Pipefy API
Pipefy + Ragic
 
Try it
Create Record with Ragic API on Card Late from Pipefy API
Pipefy + Ragic
 
Try it
New Created Record (Instant) from the Ragic API

Emit new event when a record is created. Instructions on creating webhooks here

 
Try it
New Updated Record (Instant) from the Ragic API

Emit new event when a record is updated. Instructions on creating webhooks here

 
Try it
Card Created (Instant) from the Pipefy API

Emits an event for each new card created in a Pipe.

 
Try it
Card Done (Instant) from the Pipefy API

Emits an event each time a card is moved to Done a Pipe.

 
Try it
Card Expired from the Pipefy API

Emits an event each time a card becomes expired in a Pipe.

 
Try it
Create Record with the Ragic API

Creates a record. See the docs.

 
Try it
Update Record with the Ragic API

Updates a record. See the docs.

 
Try it
Create Card with the Pipefy API

Create a new Card in a Pipe. See the docs here

 
Try it
Create Pipe with the Pipefy API

Creates a pipe. See the docs here

 
Try it
Create Table Record with the Pipefy API

Creates a new table record. See the docs here

 
Try it

Explore Other Apps

1
-
24
of
2,700+
apps by most popular

HTTP / Webhook
HTTP / Webhook
Get a unique URL where you can send HTTP or webhook requests
Node
Node
Anything you can do with Node.js, you can do in a Pipedream workflow. This includes using most of npm's 400,000+ packages.
Python
Python
Anything you can do in Python can be done in a Pipedream Workflow. This includes using any of the 350,000+ PyPi packages available in your Python powered workflows.
Pipedream Utils
Pipedream Utils
Utility functions to use within your Pipedream workflows
Notion
Notion
Notion is a new tool that blends your everyday work apps into one. It's the all-in-one workspace for you and your team.
OpenAI (ChatGPT)
OpenAI (ChatGPT)
OpenAI is an AI research and deployment company with the mission to ensure that artificial general intelligence benefits all of humanity. They are the makers of popular models like ChatGPT, DALL-E, and Whisper.
Anthropic (Claude)
Anthropic (Claude)
AI research and products that put safety at the frontier. Introducing Claude, a next-generation AI assistant for your tasks, no matter the scale.
Google Sheets
Google Sheets
Use Google Sheets to create and edit online spreadsheets. Get insights together with secure sharing in real-time and from any device.
Telegram
Telegram
Telegram, is a cloud-based, cross-platform, encrypted instant messaging (IM) service.
Google Drive
Google Drive
Google Drive is a file storage and synchronization service which allows you to create and share your work online, and access your documents from anywhere.
Pinterest
Pinterest
Pinterest is a visual discovery engine for finding ideas like recipes, home and style inspiration, and more.
Google Calendar
Google Calendar
With Google Calendar, you can quickly schedule meetings and events and get reminders about upcoming activities, so you always know what’s next.
Shopify
Shopify
Shopify is a complete commerce platform that lets anyone start, manage, and grow a business. You can use Shopify to build an online store, manage sales, market to customers, and accept payments in digital and physical locations.
Supabase
Supabase
Supabase is an open source Firebase alternative.
MySQL
MySQL
MySQL is an open-source relational database management system.
PostgreSQL
PostgreSQL
PostgreSQL is a free and open-source relational database management system emphasizing extensibility and SQL compliance.
Premium
AWS
AWS
Amazon Web Services (AWS) offers reliable, scalable, and inexpensive cloud computing services.
Premium
Twilio SendGrid
Twilio SendGrid
Send marketing and transactional email through the Twilio SendGrid platform with the Email API, proprietary mail transfer agent, and infrastructure for scalable delivery.
Amazon SES
Amazon SES
Amazon SES is a cloud-based email service provider that can integrate into any application for high volume email automation
Premium
Klaviyo
Klaviyo
Email Marketing and SMS Marketing Platform
Premium
Zendesk
Zendesk
Zendesk is award-winning customer service software trusted by 200K+ customers. Make customers happy via text, mobile, phone, email, live chat, social media.
Premium
ServiceNow
ServiceNow
The smarter way to workflow
Slack
Slack
Slack is a channel-based messaging platform. With Slack, people can work together more effectively, connect all their software tools and services, and find the information they need to do their best work — all within a secure, enterprise-grade environment.
Microsoft Teams
Microsoft Teams
Microsoft Teams has communities, events, chats, channels, meetings, storage, tasks, and calendars in one place.