← Short.io + Cloudflare integrations

Create DNS Record with Cloudflare API on New Link Created from Short.io API

Pipedream makes it easy to connect APIs for Cloudflare, Short.io and 2,700+ other apps remarkably fast.

Trigger workflow on
New Link Created from the Short.io API
Next, do this
Create DNS Record with the Cloudflare API
No credit card required
Intro to Pipedream
Watch us build a workflow
Watch us build a workflow
8 min
Watch now ➜

Trusted by 1,000,000+ developers from startups to Fortune 500 companies

Adyen logo
Appcues logo
Bandwidth logo
Checkr logo
ChartMogul logo
Dataminr logo
Gopuff logo
Gorgias logo
LinkedIn logo
Logitech logo
Replicated logo
Rudderstack logo
SAS logo
Scale AI logo
Webflow logo
Warner Bros. logo
Adyen logo
Appcues logo
Bandwidth logo
Checkr logo
ChartMogul logo
Dataminr logo
Gopuff logo
Gorgias logo
LinkedIn logo
Logitech logo
Replicated logo
Rudderstack logo
SAS logo
Scale AI logo
Webflow logo
Warner Bros. logo

Developers Pipedream

Getting Started

This integration creates a workflow with a Short.io trigger and Cloudflare action. When you configure and deploy the workflow, it will run on Pipedream's servers 24x7 for free.

  1. Select this integration
  2. Configure the New Link Created trigger
    1. Connect your Short.io account
    2. Configure Watching timer
    3. Select a Domain Id
  3. Configure the Create DNS Record action
    1. Connect your Cloudflare account
    2. Configure zone_id
    3. Select a type
    4. Configure name
    5. Configure content
    6. Configure ttl
    7. Optional- Configure proxied
    8. Optional- Configure priority
  4. Deploy the workflow
  5. Send a test event to validate your setup
  6. Turn on the trigger

Details

This integration uses pre-built, source-available components from Pipedream's GitHub repo. These components are developed by Pipedream and the community, and verified and maintained by Pipedream.

To contribute an update to an existing component or create a new component, create a PR on GitHub. If you're new to Pipedream component development, you can start with quickstarts for trigger span and action development, and then review the component API reference.

Trigger

Description:Emit new event when a link is created.
Version:0.0.4
Key:short-new-link-created

Short.io Overview

Short.io provides a robust API for URL shortening, allowing you to create, delete, and track shortened links programmatically. By integrating with Pipedream, you can automate link creation or aggregation of click data in real-time, triggering workflows in response to events like link clicks or creating short links in bulk from a data source.

Trigger Code

import shortApp from "../../short.app.mjs";
import { DEFAULT_POLLING_SOURCE_TIMER_INTERVAL } from "@pipedream/platform";

export default {
  key: "short-new-link-created",
  name: "New Link Created",
  description: "Emit new event when a link is created.",
  version: "0.0.4",
  type: "source",
  dedupe: "unique",
  props: {
    shortApp,
    timer: {
      type: "$.interface.timer",
      label: "Watching timer",
      description: "How often to watch the links.",
      default: {
        intervalSeconds: DEFAULT_POLLING_SOURCE_TIMER_INTERVAL,
      },
    },
    domainId: {
      propDefinition: [
        shortApp,
        "domainId",
      ],
    },
  },
  methods: {
    emit(meta) {
      const ts = Date.parse(meta.createdAt);
      this.$emit(meta, {
        id: meta.idString,
        summary: meta.secureShortURL,
        ts,
      });
    },
  },
  async run() {
    const links = await this.shortApp.listLinks(this.domainId);
    for (const link of links) {
      this.emit(link);
    }
  },
};

Trigger Configuration

This component may be configured based on the props defined in the component code. Pipedream automatically prompts for input values in the UI and CLI.
LabelPropTypeDescription
Short.ioshortAppappThis component uses the Short.io app.
Watching timertimer$.interface.timer

How often to watch the links.

Domain IddomainIdintegerSelect a value from the drop down menu.

Trigger Authentication

Short.io uses API keys for authentication. When you connect your Short.io account, Pipedream securely stores the keys so you can easily authenticate to Short.io APIs in both code and no-code steps.

Get your secret key here

About Short.io

White label URL Shortener

Action

Description:Creates a DNS Record given its zone id
Version:0.1.2
Key:cloudflare_api_key-create-dns-record

Cloudflare Overview

Harness the power of Cloudflare within Pipedream's scalable platform to automate and optimize your web operations. The Cloudflare API enables you to programmatically control countless aspects of your web presence, from security settings and firewall rules to traffic and DNS management. By integrating this with Pipedream, you can create custom workflows that react to specific triggers, manipulate Cloudflare configurations on-the-fly, and connect to countless other services for a seamless automation experience.

Action Code

// legacy_hash_id: a_K5iLqd
import { axios } from "@pipedream/platform";

export default {
  key: "cloudflare_api_key-create-dns-record",
  name: "Create DNS Record",
  description: "Creates a DNS Record given its zone id",
  version: "0.1.2",
  type: "action",
  props: {
    cloudflare_api_key: {
      type: "app",
      app: "cloudflare_api_key",
    },
    zone_id: {
      type: "string",
      description: "The zone ID where the DNS record being created belongs to.",
    },
    type: {
      type: "string",
      description: "DNS record type.",
      options: [
        "A",
        "AAAA",
        "CNAME",
        "TXT",
        "SRV",
        "LOC",
        "MX",
        "NS",
        "SPF",
        "CERT",
        "DNSKEY",
        "NAPTR",
        "SMIMEA",
        "SSHFP",
        "TLSA",
        "URI",
        "NS",
      ],
    },
    name: {
      type: "string",
      description: "DNS record name.",
    },
    content: {
      type: "string",
      description: "DNS record content.",
    },
    ttl: {
      type: "integer",
      description: "Time to live for DNS record. Value of 1 is 'automatic'.",
    },
    proxied: {
      type: "boolean",
      description: "Whether the record is receiving the performance and security benefits of Cloudflare",
      optional: true,
    },
    priority: {
      type: "string",
      description: "Used with some records like MX and SRV to determine priority. If you do not supply a priority for an MX record, a default value of 0 will be set.",
      optional: true,
    },
  },
  async run({ $ }) {

    return await axios($, {
      method: "post",
      url: `https://api.cloudflare.com/client/v4/zones/${this.zone_id}/dns_records`,
      headers: {
        "X-Auth-Email": `${this.cloudflare_api_key.$auth.Email}`,
        "X-Auth-Key": `${this.cloudflare_api_key.$auth.API_Key}`,
        "Content-Type": "application/json",

      },
      data: {
        type: this.type,
        name: this.name,
        content: this.content,
        ttl: this.ttl,
        proxied: this.proxied,
        priority: this.priority,
      },
    });
  },
};

Action Configuration

This component may be configured based on the props defined in the component code. Pipedream automatically prompts for input values in the UI.

LabelPropTypeDescription
Cloudflarecloudflare_api_keyappThis component uses the Cloudflare app.
zone_idzone_idstring

The zone ID where the DNS record being created belongs to.

typetypestringSelect a value from the drop down menu:AAAAACNAMETXTSRVLOCMXNSSPFCERTDNSKEYNAPTRSMIMEASSHFPTLSAURINS
namenamestring

DNS record name.

contentcontentstring

DNS record content.

ttlttlinteger

Time to live for DNS record. Value of 1 is 'automatic'.

proxiedproxiedboolean

Whether the record is receiving the performance and security benefits of Cloudflare

priorityprioritystring

Used with some records like MX and SRV to determine priority. If you do not supply a priority for an MX record, a default value of 0 will be set.

Action Authentication

Cloudflare uses API keys for authentication. When you connect your Cloudflare account, Pipedream securely stores the keys so you can easily authenticate to Cloudflare APIs in both code and no-code steps.

Visit My Profile to generate an API Token. More details in Cloudflare docs

About Cloudflare

CDN, DDoS mitigation, Internet security, and DNS services

More Ways to Connect Cloudflare + Short.io

Change Zone's SSL Setting with Cloudflare API on New Link Created from Short.io API
Short.io + Cloudflare
 
Try it
Create a Certificate with Cloudflare API on New Link Created from Short.io API
Short.io + Cloudflare
 
Try it
Create Zone with Cloudflare API on New Link Created from Short.io API
Short.io + Cloudflare
 
Try it
Delete DNS Record with Cloudflare API on New Link Created from Short.io API
Short.io + Cloudflare
 
Try it
Export DNS Records with Cloudflare API on New Link Created from Short.io API
Short.io + Cloudflare
 
Try it
New Link Created from the Short.io API

Emit new event when a link is created.

 
Try it
Create Link with the Short.io API

Create a Short Link. See the documentation

 
Try it
Delete Link with the Short.io API

Delete a Short Link. See the documentation

 
Try it
Expire Link with the Short.io API

Expire a short link by id. See the documentation

 
Try it
Get Domain Statistics with the Short.io API

Returns detailed statistics for a domain in given period. See the documentation

 
Try it
Update Link with the Short.io API

Update original URL, title or path for existing URL by id. See the documentation

 
Try it

Explore Other Apps

1
-
24
of
2,700+
apps by most popular

HTTP / Webhook
HTTP / Webhook
Get a unique URL where you can send HTTP or webhook requests
Node
Node
Anything you can do with Node.js, you can do in a Pipedream workflow. This includes using most of npm's 400,000+ packages.
Python
Python
Anything you can do in Python can be done in a Pipedream Workflow. This includes using any of the 350,000+ PyPi packages available in your Python powered workflows.
Pipedream Utils
Pipedream Utils
Utility functions to use within your Pipedream workflows
OpenAI (ChatGPT)
OpenAI (ChatGPT)
OpenAI is an AI research and deployment company with the mission to ensure that artificial general intelligence benefits all of humanity. They are the makers of popular models like ChatGPT, DALL-E, and Whisper.
Premium
Salesforce
Salesforce
Cloud-based customer relationship management (CRM) platform that helps businesses manage sales, marketing, customer support, and other business activities, ultimately aiming to improve customer relationships and streamline operations.
Premium
HubSpot
HubSpot
HubSpot's CRM platform contains the marketing, sales, service, operations, and website-building software you need to grow your business.
Premium
Zoho CRM
Zoho CRM
Zoho CRM is an online Sales CRM software that manages your sales, marketing, and support in one CRM platform.
Premium
Stripe
Stripe
Stripe powers online and in-person payment processing and financial solutions for businesses of all sizes.
Shopify
Shopify
Shopify is a complete commerce platform that lets anyone start, manage, and grow a business. You can use Shopify to build an online store, manage sales, market to customers, and accept payments in digital and physical locations.
Premium
WooCommerce
WooCommerce
WooCommerce is the open-source ecommerce platform for WordPress.
Premium
Snowflake
Snowflake
A data warehouse built for the cloud
Premium
MongoDB
MongoDB
MongoDB is an open source NoSQL database management program.
Supabase
Supabase
Supabase is an open source Firebase alternative.
MySQL
MySQL
MySQL is an open-source relational database management system.
PostgreSQL
PostgreSQL
PostgreSQL is a free and open-source relational database management system emphasizing extensibility and SQL compliance.
Premium
AWS
AWS
Amazon Web Services (AWS) offers reliable, scalable, and inexpensive cloud computing services.
Premium
Twilio SendGrid
Twilio SendGrid
Send marketing and transactional email through the Twilio SendGrid platform with the Email API, proprietary mail transfer agent, and infrastructure for scalable delivery.
Amazon SES
Amazon SES
Amazon SES is a cloud-based email service provider that can integrate into any application for high volume email automation
Premium
Klaviyo
Klaviyo
Email Marketing and SMS Marketing Platform
Premium
Zendesk
Zendesk
Zendesk is award-winning customer service software trusted by 200K+ customers. Make customers happy via text, mobile, phone, email, live chat, social media.
Premium
ServiceNow
ServiceNow
The smarter way to workflow
Notion
Notion
Notion is a new tool that blends your everyday work apps into one. It's the all-in-one workspace for you and your team.
Slack
Slack
Slack is a channel-based messaging platform. With Slack, people can work together more effectively, connect all their software tools and services, and find the information they need to do their best work — all within a secure, enterprise-grade environment.