← AWS + DigitalRiver integrations

Update Customer Information with DigitalRiver API on New Scheduled Tasks from AWS API

Pipedream makes it easy to connect APIs for DigitalRiver, AWS and 2,400+ other apps remarkably fast.

Trigger workflow on
New Scheduled Tasks from the AWS API
Next, do this
Update Customer Information with the DigitalRiver API
No credit card required
Intro to Pipedream
Watch us build a workflow
Watch us build a workflow
8 min
Watch now ➜

Trusted by 1,000,000+ developers from startups to Fortune 500 companies

Adyen logo
Appcues logo
Bandwidth logo
Checkr logo
ChartMogul logo
Dataminr logo
Gopuff logo
Gorgias logo
LinkedIn logo
Logitech logo
Replicated logo
Rudderstack logo
SAS logo
Scale AI logo
Webflow logo
Warner Bros. logo
Adyen logo
Appcues logo
Bandwidth logo
Checkr logo
ChartMogul logo
Dataminr logo
Gopuff logo
Gorgias logo
LinkedIn logo
Logitech logo
Replicated logo
Rudderstack logo
SAS logo
Scale AI logo
Webflow logo
Warner Bros. logo

Developers Pipedream

Getting Started

This integration creates a workflow with a AWS trigger and DigitalRiver action. When you configure and deploy the workflow, it will run on Pipedream's servers 24x7 for free.

  1. Select this integration
  2. Configure the New Scheduled Tasks trigger
    1. Connect your AWS account
    2. Select a AWS Region
    3. Optional- Configure Secret
  3. Configure the Update Customer Information action
    1. Connect your DigitalRiver account
    2. Select a Customer ID
    3. Optional- Configure Email
    4. Optional- Configure Shipping Address Line 1
    5. Optional- Configure Shipping Address Line 2
    6. Optional- Configure Shipping Address City
    7. Optional- Configure Shipping Address Postal Code
    8. Optional- Configure Shipping Address State
    9. Optional- Select a Shipping Address Country
    10. Optional- Configure Shipping Name
    11. Optional- Configure Shipping Phone
    12. Optional- Configure Shipping Email
    13. Optional- Configure Shipping Organization
    14. Optional- Configure Shipping Neighborhood
    15. Optional- Configure Shipping Division
    16. Optional- Configure Shipping Phonetic Name
    17. Optional- Configure Tax Certificate Company Name
    18. Optional- Configure Tax Certificate Autority
    19. Optional- Configure Tax Certificate Start Date
    20. Optional- Configure Tax Certificate End Date
    21. Optional- Select a Tax Certificate File Id
    22. Optional- Configure Request To Be Forgotten
    23. Optional- Select a Type
    24. Optional- Configure Metadata
    25. Optional- Configure Locale
    26. Optional- Configure Enabled
  4. Deploy the workflow
  5. Send a test event to validate your setup
  6. Turn on the trigger

Details

This integration uses pre-built, source-available components from Pipedream's GitHub repo. These components are developed by Pipedream and the community, and verified and maintained by Pipedream.

To contribute an update to an existing component or create a new component, create a PR on GitHub. If you're new to Pipedream component development, you can start with quickstarts for trigger span and action development, and then review the component API reference.

Trigger

Description:Creates a Step Function State Machine to publish a message to an SNS topic at a specific timestamp. The SNS topic delivers the message to this Pipedream source, and the source emits it as a new event.
Version:0.4.2
Key:aws-new-scheduled-tasks

AWS Overview

The AWS API unlocks endless possibilities for automation with Pipedream. With this powerful combo, you can manage your AWS services and resources, automate deployment workflows, process data, and react to events across your AWS infrastructure. Pipedream offers a serverless platform for creating workflows triggered by various events that can execute AWS SDK functions, making it an efficient tool to integrate, automate, and orchestrate tasks across AWS services and other apps.

Trigger Code

import base from "../common/scheduled.mjs";
import { toSingleLineString } from "../../common/utils.mjs";

export default {
  ...base,
  key: "aws-new-scheduled-tasks",
  name: "New Scheduled Tasks",
  description: toSingleLineString(`
    Creates a Step Function State Machine to publish a message
    to an SNS topic at a specific timestamp. The SNS topic delivers
    the message to this Pipedream source, and the source emits it as a new event.
  `),
  version: "0.4.2",
  type: "source",
  dedupe: "unique", // Dedupe on SNS message ID
  methods: {
    ...base.methods,
    getStateMachineDefinition() {
      const { PD_COMPONENT: componentId } = process.env;
      const topicArn = this.getTopicArn();
      return {
        Comment: `Task Scheduler for Pipedream component ${componentId}`,
        StartAt: "Wait",
        States: {
          Wait: {
            Comment: "Wait until specified timestamp",
            Type: "Wait",
            TimestampPath: "$.timestamp",
            Next: "SendMessageToSNS",
          },
          SendMessageToSNS: {
            Type: "Task",
            Resource: "arn:aws:states:::sns:publish",
            Parameters: {
              "TopicArn": topicArn,
              "Message.$": "$",
            },
            End: true,
          },
        },
      };
    },
    getStateMachinePermissions() {
      const topicArn = this.getTopicArn();
      const document = {
        Version: "2012-10-17",
        Statement: [
          {
            Effect: "Allow",
            Action: [
              "sns:Publish",
            ],
            Resource: [
              topicArn,
            ],
          },
        ],
      };
      const name = "publish-messages-to-pipedream-sns-topic";
      return {
        document,
        name,
      };
    },
  },
};

Trigger Configuration

This component may be configured based on the props defined in the component code. Pipedream automatically prompts for input values in the UI and CLI.
LabelPropTypeDescription
AWSawsappThis component uses the AWS app.
N/Adb$.service.dbThis component uses $.service.db to maintain state between executions.
N/Ahttp$.interface.httpThis component uses $.interface.http to generate a unique URL when the component is first instantiated. Each request to the URL will trigger the run() method of the component.
AWS RegionregionstringSelect a value from the drop down menu.
Secretsecretstring

Optional but recommended: if you enter a secret here, you must pass this value in the secret parameter of each HTTP POST request

Trigger Authentication

AWS uses API keys for authentication. When you connect your AWS account, Pipedream securely stores the keys so you can easily authenticate to AWS APIs in both code and no-code steps.

Follow the AWS Instructions for creating an IAM user with an associated access and secret key.

As a best practice, attach the minimum set of IAM permissions necessary to perform the specific task in Pipedream. If your workflow only needs to perform a single API call, you should create a user and associate an IAM group / policy with permission to do only that task. You can create as many linked AWS accounts in Pipedream as you'd like.

Enter your access and secret key below.

About AWS

Amazon Web Services (AWS) offers reliable, scalable, and inexpensive cloud computing services.

Action

Description:Updates the information for a customer in Digital River. [See the documentation](https://www.digitalriver.com/docs/digital-river-api-reference/#tag/Customers/operation/updateCustomers)
Version:0.0.1
Key:digitalriver-update-customer-information

DigitalRiver Overview

The DigitalRiver API lets you manage e-commerce activities like orders, payments, and customer information. On Pipedream, you can harness this API to create automated workflows that integrate with other apps, react to events, process transactions, and handle global e-commerce complexities. Pipedream's serverless platform enables you to build and execute these workflows quickly, without setting up infrastructure, and to connect DigitalRiver with countless other services for a seamless e-commerce ecosystem.

Action Code

import { COUNTRY_OPTIONS } from "../../common/constants.mjs";
import { clearObj } from "../../common/utils.mjs";
import digitalriver from "../../digitalriver.app.mjs";

export default {
  key: "digitalriver-update-customer-information",
  name: "Update Customer Information",
  description: "Updates the information for a customer in Digital River. [See the documentation](https://www.digitalriver.com/docs/digital-river-api-reference/#tag/Customers/operation/updateCustomers)",
  version: "0.0.1",
  type: "action",
  props: {
    digitalriver,
    customerId: {
      propDefinition: [
        digitalriver,
        "customerId",
      ],
    },
    email: {
      type: "string",
      label: "Email",
      description: "The customer email address.",
      optional: true,
    },
    line1: {
      type: "string",
      label: "Shipping Address Line 1",
      description: "The first line of the address.",
      optional: true,
    },
    line2: {
      type: "string",
      label: "Shipping Address Line 2",
      description: "The second line of the address.",
      optional: true,
    },
    city: {
      type: "string",
      label: "Shipping Address City",
      description: "The city of the address.",
      optional: true,
    },
    postalCode: {
      type: "string",
      label: "Shipping Address Postal Code",
      description: "The postal code of the address.",
      optional: true,
    },
    state: {
      type: "string",
      label: "Shipping Address State",
      description: "The state, county, province, or region.",
      optional: true,
    },
    country: {
      type: "string",
      label: "Shipping Address Country",
      description: "A [two-letter Alpha-2 country code](https://www.iban.com/country-codes) as described in the [ISO 3166](https://www.iso.org/iso-3166-country-codes.html) international standard.",
      options: COUNTRY_OPTIONS,
      optional: true,
    },
    name: {
      type: "string",
      label: "Shipping Name",
      description: "The recipient's name.",
      optional: true,
    },
    phone: {
      type: "string",
      label: "Shipping Phone",
      description: "The recipient's phone number.",
      optional: true,
    },
    shippingEmail: {
      type: "string",
      label: "Shipping Email",
      description: "The recipient's email address.",
      optional: true,
    },
    organization: {
      type: "string",
      label: "Shipping Organization",
      description: "The recipient's organization.",
      optional: true,
    },
    neighborhood: {
      type: "string",
      label: "Shipping Neighborhood",
      description: "The neighborhood of the address.",
      optional: true,
    },
    division: {
      type: "string",
      label: "Shipping Division",
      description: "A division within an organization.",
      optional: true,
    },
    phoneticName: {
      type: "string",
      label: "Shipping Phonetic Name",
      description: "The phonetic spelling of a name.",
      optional: true,
    },
    companyName: {
      type: "string",
      label: "Tax Certificate Company Name",
      description: "The name of the company that holds the certificate.",
      optional: true,
    },
    taxAuthority: {
      type: "string",
      label: "Tax Certificate Autority",
      description: "The issuing state.",
      optional: true,
    },
    startDate: {
      type: "string",
      label: "Tax Certificate Start Date",
      description: "Tax certificate start date.",
      optional: true,
    },
    endDate: {
      type: "string",
      label: "Tax Certificate End Date",
      description: "Tax certificate end date.",
      optional: true,
    },
    fileId: {
      propDefinition: [
        digitalriver,
        "fileId",
      ],
      label: "Tax Certificate File Id",
      description: "The identifier of the file that contains the tax certificate.",
      optional: true,
    },
    requestToBeForgotten: {
      type: "boolean",
      label: "Request To Be Forgotten",
      description: "If `true`, indicates this customer has submitted a request to be forgotten.",
      optional: true,
    },
    type: {
      type: "string",
      label: "Type",
      description: "The type of customer.",
      options: [
        "business",
        "individual",
      ],
      optional: true,
    },
    metadata: {
      propDefinition: [
        digitalriver,
        "metadata",
      ],
      optional: true,
    },
    locale: {
      type: "string",
      label: "Locale",
      description: "A locale designator that combines the two-letter ISO 639-1 language code with the ISO 3166-1 alpha-2 country code.",
      optional: true,
    },
    enabled: {
      type: "boolean",
      label: "Enabled",
      description: "Usually used to disable the customer. The default is true. If false, attempts to create orders for the customer will fail.",
      optional: true,
    },
  },
  async run({ $ }) {
    const {
      digitalriver,
      customerId,
      line1,
      line2,
      city,
      postalCode,
      state,
      country,
      name,
      phone,
      shippingEmail,
      organization,
      neighborhood,
      division,
      phoneticName,
      companyName,
      taxAuthority,
      startDate,
      endDate,
      fileId,
      ...data
    } = this;

    const response = await digitalriver.updateCustomer({
      $,
      customerId,
      data: clearObj({
        ...data,
        shipping: {
          address: {
            line1,
            line2,
            city,
            postalCode,
            state,
            country,
          },
          name,
          phone,
          email: shippingEmail,
          organization,
          additionalAddressInfo: {
            neighborhood,
            division,
            phoneticName,
          },
        },
        taxCertificate: {
          companyName,
          taxAuthority,
          startDate,
          endDate,
          fileId,
        },
      }),
    });

    $.export("$summary", `Updated customer information for contact ID ${this.customerId}`);
    return response;
  },
};

Action Configuration

This component may be configured based on the props defined in the component code. Pipedream automatically prompts for input values in the UI.

LabelPropTypeDescription
DigitalRiverdigitalriverappThis component uses the DigitalRiver app.
Customer IDcustomerIdstringSelect a value from the drop down menu.
Emailemailstring

The customer email address.

Shipping Address Line 1line1string

The first line of the address.

Shipping Address Line 2line2string

The second line of the address.

Shipping Address Citycitystring

The city of the address.

Shipping Address Postal CodepostalCodestring

The postal code of the address.

Shipping Address Statestatestring

The state, county, province, or region.

Shipping Address CountrycountrystringSelect a value from the drop down menu:AFALDZASADAOAIAQAGARAMAWAUATAZBSBHBDBBBYBEBZBJBMBTBOBQBABWBVBRIOBNBGBFBICVKHCMCAKYCFTDCLCNCXCCCOKMCDCGCKCRHRCUCWCYCZCIDKDJDMDOECEGSVGQEREESZETFKFOFJFIFRGFPFTFGAGMGEDEGHGIGRGLGDGPGUGTGGGNGWGYHTHMVAHNHKHUISINIDIRIQIEIMILITJMJPJEJOKZKEKIKPKRKWKGLALVLBLSLRLYLILTLUMOMGMWMYMVMLMTMHMQMRMUYTMXFMMDMCMNMEMSMAMZMMNANRNPNLNCNZNINENGNUNFMPNOOMPKPWPSPAPGPYPEPHPNPLPTPRQAMKRORURWREBLSHKNLCMFPMVCWSSMSTSASNRSSCSLSGSXSKSISBSOZAGSSSESLKSDSRSJSECHSYTWTJTZTHTLTGTKTOTTTNTRTMTCTVUGUAAEGBUMUSUYUZVUVEVNVGVIWFEHYEZMZWAX
Shipping Namenamestring

The recipient's name.

Shipping Phonephonestring

The recipient's phone number.

Shipping EmailshippingEmailstring

The recipient's email address.

Shipping Organizationorganizationstring

The recipient's organization.

Shipping Neighborhoodneighborhoodstring

The neighborhood of the address.

Shipping Divisiondivisionstring

A division within an organization.

Shipping Phonetic NamephoneticNamestring

The phonetic spelling of a name.

Tax Certificate Company NamecompanyNamestring

The name of the company that holds the certificate.

Tax Certificate AutoritytaxAuthoritystring

The issuing state.

Tax Certificate Start DatestartDatestring

Tax certificate start date.

Tax Certificate End DateendDatestring

Tax certificate end date.

Tax Certificate File IdfileIdstringSelect a value from the drop down menu.
Request To Be ForgottenrequestToBeForgottenboolean

If true, indicates this customer has submitted a request to be forgotten.

TypetypestringSelect a value from the drop down menu:businessindividual
Metadatametadataobject

Key-value pairs used to store additional data. Value can be string, boolean or integer types.

Localelocalestring

A locale designator that combines the two-letter ISO 639-1 language code with the ISO 3166-1 alpha-2 country code.

Enabledenabledboolean

Usually used to disable the customer. The default is true. If false, attempts to create orders for the customer will fail.

Action Authentication

DigitalRiver uses API keys for authentication. When you connect your DigitalRiver account, Pipedream securely stores the keys so you can easily authenticate to DigitalRiver APIs in both code and no-code steps.

Sign in and copy your API key from your Dashboard under API Keys.

About DigitalRiver

The ultimate ecommerce accelerator for global growth. Fast, easy, risk-free expansion into 240+ destinations. Accelerate. Simplify. Optimize.

More Ways to Connect DigitalRiver + AWS

Cancel Order with DigitalRiver API on New Records Returned by CloudWatch Logs Insights Query from AWS API
AWS + DigitalRiver
 
Try it
Create a Product with DigitalRiver API on New Records Returned by CloudWatch Logs Insights Query from AWS API
AWS + DigitalRiver
 
Try it
Update Customer Information with DigitalRiver API on New Records Returned by CloudWatch Logs Insights Query from AWS API
AWS + DigitalRiver
 
Try it
Cancel Order with DigitalRiver API on New DynamoDB Stream Event from AWS API
AWS + DigitalRiver
 
Try it
Create a Product with DigitalRiver API on New DynamoDB Stream Event from AWS API
AWS + DigitalRiver
 
Try it
New Scheduled Tasks from the AWS API

Creates a Step Function State Machine to publish a message to an SNS topic at a specific timestamp. The SNS topic delivers the message to this Pipedream source, and the source emits it as a new event.

 
Try it
New SNS Messages from the AWS API

Creates an SNS topic in your AWS account. Messages published to this topic are emitted from the Pipedream source.

 
Try it
New Inbound SES Emails from the AWS API

The source subscribes to all emails delivered to a specific domain configured in AWS SES. When an email is sent to any address at the domain, this event source emits that email as a formatted event. These events can trigger a Pipedream workflow and can be consumed via SSE or REST API.

 
Try it
New Deleted S3 File from the AWS API

Emit new event when a file is deleted from a S3 bucket

 
Try it
New DynamoDB Stream Event from the AWS API

Emit new event when a DynamoDB stream receives new events. See the docs here

 
Try it
CloudWatch Logs - Put Log Event with the AWS API

Uploads a log event to the specified log stream. See docs

 
Try it
DynamoDB - Create Table with the AWS API

Creates a new table to your account. See docs

 
Try it
DynamoDB - Execute Statement with the AWS API

This operation allows you to perform transactional reads or writes on data stored in DynamoDB, using PartiQL. See docs

 
Try it
DynamoDB - Get Item with the AWS API

The Get Item operation returns a set of attributes for the item with the given primary key. If there is no matching item, Get Item does not return any data and there will be no Item element in the response. See docs

 
Try it
DynamoDB - Put Item with the AWS API

Creates a new item, or replaces an old item with a new item. If an item that has the same primary key as the new item already exists in the specified table, the new item completely replaces the existing item. See docs

 
Try it

Explore Other Apps

1
-
24
of
2,400+
apps by most popular

HTTP / Webhook
HTTP / Webhook
Get a unique URL where you can send HTTP or webhook requests
Node
Node
Anything you can do with Node.js, you can do in a Pipedream workflow. This includes using most of npm's 400,000+ packages.
Python
Python
Anything you can do in Python can be done in a Pipedream Workflow. This includes using any of the 350,000+ PyPi packages available in your Python powered workflows.
OpenAI (ChatGPT)
OpenAI (ChatGPT)
OpenAI is an AI research and deployment company with the mission to ensure that artificial general intelligence benefits all of humanity. They are the makers of popular models like ChatGPT, DALL-E, and Whisper.
Premium
Salesforce
Salesforce
Web services API for interacting with Salesforce
Premium
HubSpot
HubSpot
HubSpot's CRM platform contains the marketing, sales, service, operations, and website-building software you need to grow your business.
Premium
Zoho CRM
Zoho CRM
Zoho CRM is an online Sales CRM software that manages your sales, marketing, and support in one CRM platform.
Premium
Stripe
Stripe
Stripe powers online and in-person payment processing and financial solutions for businesses of all sizes.
Shopify
Shopify
Shopify is a complete commerce platform that lets anyone start, manage, and grow a business. You can use Shopify to build an online store, manage sales, market to customers, and accept payments in digital and physical locations.
Premium
WooCommerce
WooCommerce
WooCommerce is the open-source ecommerce platform for WordPress.
Premium
Snowflake
Snowflake
A data warehouse built for the cloud
Premium
MongoDB
MongoDB
MongoDB is an open source NoSQL database management program.
Supabase
Supabase
Supabase is an open source Firebase alternative.
MySQL
MySQL
MySQL is an open-source relational database management system.
PostgreSQL
PostgreSQL
PostgreSQL is a free and open-source relational database management system emphasizing extensibility and SQL compliance.
Premium
AWS
AWS
Amazon Web Services (AWS) offers reliable, scalable, and inexpensive cloud computing services.
Premium
Twilio SendGrid
Twilio SendGrid
Send marketing and transactional email through the Twilio SendGrid platform with the Email API, proprietary mail transfer agent, and infrastructure for scalable delivery.
Amazon SES
Amazon SES
Amazon SES is a cloud-based email service provider that can integrate into any application for high volume email automation
Premium
Klaviyo
Klaviyo
Email Marketing and SMS Marketing Platform
Premium
Zendesk
Zendesk
Zendesk is award-winning customer service software trusted by 200K+ customers. Make customers happy via text, mobile, phone, email, live chat, social media.
Notion
Notion
Notion is a new tool that blends your everyday work apps into one. It's the all-in-one workspace for you and your team.
Slack
Slack
Slack is a channel-based messaging platform. With Slack, people can work together more effectively, connect all their software tools and services, and find the information they need to do their best work — all within a secure, enterprise-grade environment.
Microsoft Teams
Microsoft Teams
Microsoft Teams has communities, events, chats, channels, meetings, storage, tasks, and calendars in one place.
Schedule
Schedule
Trigger workflows on an interval or cron schedule.