← AWS + Pipefy integrations

Create Pipe with Pipefy API on New Inbound SES Emails from AWS API

Pipedream makes it easy to connect APIs for Pipefy, AWS and 3,000+ other apps remarkably fast.

Trigger workflow on
New Inbound SES Emails from the AWS API
Next, do this
Create Pipe with the Pipefy API
No credit card required
Intro to Pipedream
Watch us build a workflow
Watch us build a workflow
8 min
Watch now ➜

Trusted by 1,000,000+ developers from startups to Fortune 500 companies

Adyen logo
Appcues logo
Bandwidth logo
Checkr logo
ChartMogul logo
Dataminr logo
Gopuff logo
Gorgias logo
LinkedIn logo
Logitech logo
Replicated logo
Rudderstack logo
SAS logo
Scale AI logo
Webflow logo
Warner Bros. logo
Adyen logo
Appcues logo
Bandwidth logo
Checkr logo
ChartMogul logo
Dataminr logo
Gopuff logo
Gorgias logo
LinkedIn logo
Logitech logo
Replicated logo
Rudderstack logo
SAS logo
Scale AI logo
Webflow logo
Warner Bros. logo

Developers Pipedream

Getting Started

This integration creates a workflow with a AWS trigger and Pipefy action. When you configure and deploy the workflow, it will run on Pipedream's servers 24x7 for free.

  1. Select this integration
  2. Configure the New Inbound SES Emails trigger
    1. Connect your AWS account
    2. Select a AWS Region
    3. Select a SES Domain
  3. Configure the Create Pipe action
    1. Connect your Pipefy account
    2. Select a Organization
    3. Configure Name
    4. Configure Phase Names
    5. Optional- Select one or more Members
    6. Optional- Select a Icon
  4. Deploy the workflow
  5. Send a test event to validate your setup
  6. Turn on the trigger

Details

This integration uses pre-built, source-available components from Pipedream's GitHub repo. These components are developed by Pipedream and the community, and verified and maintained by Pipedream.

To contribute an update to an existing component or create a new component, create a PR on GitHub. If you're new to Pipedream component development, you can start with quickstarts for trigger span and action development, and then review the component API reference.

Trigger

Description:The source subscribes to all emails delivered to a specific domain configured in AWS SES. When an email is sent to any address at the domain, this event source emits that email as a formatted event. These events can trigger a Pipedream workflow and can be consumed via SSE or REST API.
Version:1.2.6
Key:aws-new-emails-sent-to-ses-catch-all-domain

AWS Overview

The AWS API unlocks endless possibilities for automation with Pipedream. With this powerful combo, you can manage your AWS services and resources, automate deployment workflows, process data, and react to events across your AWS infrastructure. Pipedream offers a serverless platform for creating workflows triggered by various events that can execute AWS SDK functions, making it an efficient tool to integrate, automate, and orchestrate tasks across AWS services and other apps.

Trigger Code

import { v4 as uuid } from "uuid";
import base from "../common/ses.mjs";
import commonS3 from "../../common/common-s3.mjs";
import { toSingleLineString } from "../../common/utils.mjs";
import { simpleParser } from "mailparser";

export default {
  ...base,
  key: "aws-new-emails-sent-to-ses-catch-all-domain",
  name: "New Inbound SES Emails",
  description: toSingleLineString(`
    The source subscribes to all emails delivered to a
    specific domain configured in AWS SES.
    When an email is sent to any address at the domain,
    this event source emits that email as a formatted event.
    These events can trigger a Pipedream workflow and can be consumed via SSE or REST API.
  `),
  type: "source",
  version: "1.2.6",
  props: {
    ...base.props,
    domain: {
      label: "SES Domain",
      description: "The domain you'd like to configure a catch-all handler for",
      type: "string",
      async options() {
        const { Identities: identities } = await this.listIdentities();
        return identities;
      },
    },
  },
  methods: {
    ...base.methods,
    ...commonS3.methods,
    getReceiptRule(bucketName, topicArn) {
      const name = `pd-catchall-${uuid()}`;
      const rule = {
        Name: name,
        Enabled: true,
        Actions: [
          {
            S3Action: {
              TopicArn: topicArn,
              BucketName: bucketName,
            },
          },
        ],
        Recipients: [
          this.domain,
        ],
        ScanEnabled: true,
      };
      return {
        name,
        rule,
      };
    },
    async processEvent(event) {
      const { body } = event;
      const { Message: rawMessage } = body;
      if (!rawMessage) {
        console.log("No message present, exiting");
        return;
      }

      const { "x-amz-sns-message-id": id } = event.headers;
      const { Timestamp: ts } = event.body;
      const meta = {
        id,
        ts,
      };

      try {
        const message = JSON.parse(rawMessage);
        const {
          bucketName: Bucket,
          objectKey: Key,
        } = message.receipt.action;

        const { Body } = await this.getObject({
          Bucket,
          Key,
        });
        const parsed = await simpleParser(Body);
        for (const attachment of parsed.attachments || []) {
          if (!attachment.content) continue;
          attachment.content_b64 = attachment.content.toString("base64");
          delete attachment.content;
        }

        // Emit to the default channel
        this.$emit(parsed, {
          id,
          summary: parsed.subject,
          ts,
        });

        // and a channel specific to the email address
        const address = parsed.to?.[0]?.address;
        if (address) {
          this.$emit(parsed, {
            id,
            name: address,
            summary: parsed.subject,
            ts,
          });
        }
      } catch (err) {
        console.log(
          `Couldn't parse message. Emitting raw message. Error: ${err}`,
        );
        this.$emit({
          rawMessage,
        }, {
          ...meta,
          summary: "Couldn't parse message",
        });
      }
    },
  },
};

Trigger Configuration

This component may be configured based on the props defined in the component code. Pipedream automatically prompts for input values in the UI and CLI.
LabelPropTypeDescription
AWSawsappThis component uses the AWS app.
N/Adb$.service.dbThis component uses $.service.db to maintain state between executions.
N/Ahttp$.interface.httpThis component uses $.interface.http to generate a unique URL when the component is first instantiated. Each request to the URL will trigger the run() method of the component.
AWS RegionregionstringSelect a value from the drop down menu.
SES DomaindomainstringSelect a value from the drop down menu.

Trigger Authentication

AWS uses API keys for authentication. When you connect your AWS account, Pipedream securely stores the keys so you can easily authenticate to AWS APIs in both code and no-code steps.

About AWS

Amazon Web Services (AWS) offers reliable, scalable, and inexpensive cloud computing services.

Action

Description:Creates a pipe. [See the docs here](https://api-docs.pipefy.com/reference/mutations/createPipe/)
Version:0.3.3
Key:pipefy-create-pipe

Pipefy Overview

Pipefy is a platform that empowers users to streamline complex processes and workflows without the need for technical skills. With the Pipefy API, you can automate various aspects of your Pipefy environment, such as creating cards, updating fields, and managing pipelines programmatically. Use Pipedream to connect Pipefy with 3,000+ other apps and orchestrate workflows that can save time, reduce errors, and enhance efficiency.

Action Code

import pipefy from "../../pipefy.app.mjs";
import constants from "../common/constants.mjs";

export default {
  key: "pipefy-create-pipe",
  name: "Create Pipe",
  description: "Creates a pipe. [See the docs here](https://api-docs.pipefy.com/reference/mutations/createPipe/)",
  version: "0.3.3",
  annotations: {
    destructiveHint: false,
    openWorldHint: true,
    readOnlyHint: false,
  },
  type: "action",
  props: {
    pipefy,
    organization: {
      propDefinition: [
        pipefy,
        "organization",
      ],
    },
    name: {
      type: "string",
      label: "Name",
      description: "Name of the new Pipe",
    },
    phases: {
      type: "string[]",
      label: "Phase Names",
      description: "Names of the new Pipe's phases",
      reloadProps: true,
    },
    members: {
      propDefinition: [
        pipefy,
        "members",
        (c) => ({
          orgId: c.organization,
        }),
      ],
      withLabel: true,
      reloadProps: true,
    },
    icon: {
      type: "string",
      label: "Icon",
      description: "The Pipe icon",
      options: constants.ICON_OPTIONS,
      optional: true,
    },
  },
  async additionalProps() {
    const props = {};
    if (this.phases?.length > 0) {
      for (const phase of this.phases) {
        props[phase] = {
          type: "boolean",
          label: `${phase} Done?`,
          description: `Is ${phase} a final/done phase?`,
          default: false,
        };
      }
    }
    if (this.members?.length > 0) {
      for (const member of this.members) {
        props[member.value] = {
          type: "string",
          label: `Role for ${member.label}`,
          description: "The user role name",
          options: constants.ROLE_OPTIONS,
        };
      }
    }
    return props;
  },
  async run({ $ }) {
  /*
  Example query:

  mutation createNewPipe{
    createPipe(
        input: {name: "UsersPipe", organization_id: 300455771 } ) {
            pipe{id name}
      }
  }
  */

    const variables = {
      name: this.name,
      organizationId: this.organization,
      icon: this.icon,
    };

    if (this.phases?.length > 0) {
      const phases = [];
      for (const phase of this.phases) {
        phases.push({
          name: phase,
          done: this[phase],
        });
      }
      variables.phases = phases;
    }

    if (this.members?.length > 0) {
      const members = [];
      for (const member of this.members) {
        members.push({
          role_name: this[member.value],
          user_id: member.value,
        });
      }
      variables.members = members;
    }

    const response = await this.pipefy.createPipe(variables);
    $.export("$summary", "Successfully created pipe");
    return response;
  },
};

Action Configuration

This component may be configured based on the props defined in the component code. Pipedream automatically prompts for input values in the UI.

LabelPropTypeDescription
PipefypipefyappThis component uses the Pipefy app.
OrganizationorganizationstringSelect a value from the drop down menu.
Namenamestring

Name of the new Pipe

Phase Namesphasesstring[]

Names of the new Pipe's phases

Membersmembersstring[]Select a value from the drop down menu.
IconiconstringSelect a value from the drop down menu:airplaneataxebadgebagboatbriefingbugbullhorncalendarcartcatchart-zoomchart2chatcheckchecklistcompasscontractdogeiffelemofinish-flagflameframefroggamegithubglobegrowthhr-processhr-requestsicejuicelamplemonadelibertylikemacmagicmapmessagemkt-requestsmoneyonboardingpacmanpacman1payablephonepipefypizzaplanetplugreceivablesreceiverecruitment-requestsreloadrocketsalesskullsnow-flakestartargettasktask-managementtrophyunderwear

Action Authentication

Pipefy uses API keys for authentication. When you connect your Pipefy account, Pipedream securely stores the keys so you can easily authenticate to Pipefy APIs in both code and no-code steps.

To authorize requests to the Pipefy API, you'll need to generate a Personal access token. In order to create Pipefy triggers in Pipedream, you will need to be a Pipefy administrator.

About Pipefy

Process Management, Workflow Management Software

More Ways to Connect Pipefy + AWS

Create Card with Pipefy API on New Emails sent to SES Catch-all Domain from AWS API
AWS + Pipefy
 
Try it
Create Card with Pipefy API on New Records Returned by CloudWatch Logs Insights Query from AWS API
AWS + Pipefy
 
Try it
Create Card with Pipefy API on New Scheduled Tasks from AWS API
AWS + Pipefy
 
Try it
Create Card with Pipefy API on New SNS Messages from AWS API
AWS + Pipefy
 
Try it
Create Pipe with Pipefy API on New Records Returned by CloudWatch Logs Insights Query from AWS API
AWS + Pipefy
 
Try it
New Scheduled Tasks from the AWS API

Creates a Step Function State Machine to publish a message to an SNS topic at a specific timestamp. The SNS topic delivers the message to this Pipedream source, and the source emits it as a new event.

 
Try it
New SNS Messages from the AWS API

Creates an SNS topic in your AWS account. Messages published to this topic are emitted from the Pipedream source.

 
Try it
New Inbound SES Emails from the AWS API

The source subscribes to all emails delivered to a specific domain configured in AWS SES. When an email is sent to any address at the domain, this event source emits that email as a formatted event. These events can trigger a Pipedream workflow and can be consumed via SSE or REST API.

 
Try it
New Deleted S3 File from the AWS API

Emit new event when a file is deleted from a S3 bucket

 
Try it
New DynamoDB Stream Event from the AWS API

Emit new event when a DynamoDB stream receives new events. See the docs here

 
Try it
CloudWatch Logs - Put Log Event with the AWS API

Uploads a log event to the specified log stream. See docs

 
Try it
DynamoDB - Create Table with the AWS API

Creates a new table to your account. See docs

 
Try it
DynamoDB - Execute Statement with the AWS API

This operation allows you to perform transactional reads or writes on data stored in DynamoDB, using PartiQL. See docs

 
Try it
DynamoDB - Get Item with the AWS API

The Get Item operation returns a set of attributes for the item with the given primary key. If there is no matching item, Get Item does not return any data and there will be no Item element in the response. See docs

 
Try it
DynamoDB - Put Item with the AWS API

Creates a new item, or replaces an old item with a new item. If an item that has the same primary key as the new item already exists in the specified table, the new item completely replaces the existing item. See docs

 
Try it

Explore Other Apps

1
-
24
of
3,000+
apps by most popular

Node
Node
Anything you can do with Node.js, you can do in a Pipedream workflow. This includes using most of npm's 400,000+ packages.
Python
Python
Anything you can do in Python can be done in a Pipedream Workflow. This includes using any of the 350,000+ PyPi packages available in your Python powered workflows.
Notion
Notion
Notion is a new tool that blends your everyday work apps into one. It's the all-in-one workspace for you and your team.
OpenAI (ChatGPT)
OpenAI (ChatGPT)
OpenAI is an AI research and deployment company with the mission to ensure that artificial general intelligence benefits all of humanity. They are the makers of popular models like ChatGPT, DALL-E, and Whisper.
Anthropic (Claude)
Anthropic (Claude)
AI research and products that put safety at the frontier. Introducing Claude, a next-generation AI assistant for your tasks, no matter the scale.
Google Sheets
Google Sheets
Use Google Sheets to create and edit online spreadsheets. Get insights together with secure sharing in real-time and from any device.
Telegram
Telegram
Telegram, is a cloud-based, cross-platform, encrypted instant messaging (IM) service.
Google Drive
Google Drive
Google Drive is a file storage and synchronization service which allows you to create and share your work online, and access your documents from anywhere.
HTTP / Webhook
HTTP / Webhook
Get a unique URL where you can send HTTP or webhook requests
Google Calendar
Google Calendar
With Google Calendar, you can quickly schedule meetings and events and get reminders about upcoming activities, so you always know what’s next.
Schedule
Schedule
Trigger workflows on an interval or cron schedule.
Pipedream Utils
Pipedream Utils
Utility functions to use within your Pipedream workflows
Shopify
Shopify
Shopify is a complete commerce platform that lets anyone start, manage, and grow a business. You can use Shopify to build an online store, manage sales, market to customers, and accept payments in digital and physical locations.
Supabase
Supabase
Supabase is an open source Firebase alternative.
MySQL
MySQL
MySQL is an open-source relational database management system.
PostgreSQL
PostgreSQL
PostgreSQL is a free and open-source relational database management system emphasizing extensibility and SQL compliance.
AWS
AWS
Premium
Amazon Web Services (AWS) offers reliable, scalable, and inexpensive cloud computing services.
Twilio SendGrid
Twilio SendGrid
Premium
Send marketing and transactional email through the Twilio SendGrid platform with the Email API, proprietary mail transfer agent, and infrastructure for scalable delivery.
Amazon SES
Amazon SES
Amazon SES is a cloud-based email service provider that can integrate into any application for high volume email automation
Klaviyo
Klaviyo
Premium
Klaviyo unifies your data, channels, and AI agents in one platform—text, WhatsApp, email marketing, and more—driving growth with every interaction.
Zendesk
Zendesk
Premium
Zendesk is award-winning customer service software trusted by 200K+ customers. Make customers happy via text, mobile, phone, email, live chat, social media.
ServiceNow
ServiceNow
Premium
Beta
The smarter way to workflow
Slack
Slack
Slack is the AI-powered platform for work bringing all of your conversations, apps, and customers together in one place. Around the world, Slack is helping businesses of all sizes grow and send productivity through the roof.
Microsoft Teams
Microsoft Teams
Microsoft Teams has communities, events, chats, channels, meetings, storage, tasks, and calendars in one place.