← Mailgun + Pipefy integrations

Create Pipe with Pipefy API on New Bounce (Instant) from Mailgun API

Pipedream makes it easy to connect APIs for Pipefy, Mailgun and 2,000+ other apps remarkably fast.

Trigger workflow on
New Bounce (Instant) from the Mailgun API
Next, do this
Create Pipe with the Pipefy API
No credit card required
Intro to Pipedream
Watch us build a workflow
Watch us build a workflow
4 min
Watch now ➜

Trusted by 800,000+ developers from startups to Fortune 500 companies

Adyen logo
Appcues logo
Bandwidth logo
Checkr logo
ChartMogul logo
Dataminr logo
Gopuff logo
Gorgias logo
LinkedIn logo
Logitech logo
Replicated logo
Rudderstack logo
SAS logo
Scale AI logo
Webflow logo
Warner Bros. logo
Adyen logo
Appcues logo
Bandwidth logo
Checkr logo
ChartMogul logo
Dataminr logo
Gopuff logo
Gorgias logo
LinkedIn logo
Logitech logo
Replicated logo
Rudderstack logo
SAS logo
Scale AI logo
Webflow logo
Warner Bros. logo

Developers Pipedream

Getting Started

This integration creates a workflow with a Mailgun trigger and Pipefy action. When you configure and deploy the workflow, it will run on Pipedream's servers 24x7 for free.

  1. Select this integration
  2. Configure the New Bounce (Instant) trigger
    1. Connect your Mailgun account
    2. Select a Domain Name
    3. Configure Mailgun webhook signing key
  3. Configure the Create Pipe action
    1. Connect your Pipefy account
    2. Select a Organization
    3. Configure Name
    4. Configure Phase Names
    5. Optional- Select one or more Members
    6. Optional- Select a Icon
  4. Deploy the workflow
  5. Send a test event to validate your setup
  6. Turn on the trigger

Details

This integration uses pre-built, source-available components from Pipedream's GitHub repo. These components are developed by Pipedream and the community, and verified and maintained by Pipedream.

To contribute an update to an existing component or create a new component, create a PR on GitHub. If you're new to Pipedream component development, you can start with quickstarts for trigger span and action development, and then review the component API reference.

Trigger

Description:Emit new event when the email recipient could not be reached.
Version:0.0.2
Key:mailgun-new-bounce

Mailgun Overview

The Mailgun API on Pipedream is a potent tool for automating email operations without the overhead of managing a full-fledged email server. It offers capabilities to send, receive, track, and store emails with ease. With Pipedream's serverless platform, you can trigger workflows using Mailgun events, such as inbound emails or delivery status changes, and connect them to hundreds of other services to streamline communication, marketing, and notification systems within your ecosystem.

Trigger Code

import common from "../common/http-based.mjs";

export default {
  ...common,
  key: "mailgun-new-bounce",
  name: "New Bounce (Instant)",
  type: "source",
  description: "Emit new event when the email recipient could not be reached.",
  version: "0.0.2",
  dedupe: "unique",
  methods: {
    ...common.methods,
    getEventName() {
      return [
        "bounce",
      ];
    },
    getEventType() {
      return [
        "bounced",
      ];
    },
  },
  async run(event) {
    if (!event.body?.signature) {
      console.warn("Webhook signature missing, skipping");
      return;
    }
    if (!this.verifySignature(event.body)) {
      this.http.respond({
        status: 401,
      });
      console.warn("Webhook signature invalid, skipping");
      return;
    }
    this.emitEvent(event.body);
  },
};

Trigger Configuration

This component may be configured based on the props defined in the component code. Pipedream automatically prompts for input values in the UI and CLI.
LabelPropTypeDescription
MailgunmailgunappThis component uses the Mailgun app.
Domain NamedomainstringSelect a value from the drop down menu.
Mailgun webhook signing keywebhookSigningKeystring

Your Mailgun webhook signing key, found in your Mailgun dashboard, located under Settings on the left-hand nav and then in API Keys look for webhook signing key. Required to compute the authentication signature of events.

N/Ahttp$.interface.httpThis component uses $.interface.http to generate a unique URL when the component is first instantiated. Each request to the URL will trigger the run() method of the component.

Trigger Authentication

Mailgun uses API keys for authentication. When you connect your Mailgun account, Pipedream securely stores the keys so you can easily authenticate to Mailgun APIs in both code and no-code steps.

About Mailgun

Mailgun is an email automation service built for developers. Powerful transactional email APIs enable you to send, receive, and track emails.

Action

Description:Creates a pipe. [See the docs here](https://api-docs.pipefy.com/reference/mutations/createPipe/)
Version:0.3.2
Key:pipefy-create-pipe

Pipefy Overview

Pipefy is a platform that empowers users to streamline complex processes and workflows without the need for technical skills. With the Pipefy API, you can automate various aspects of your Pipefy environment, such as creating cards, updating fields, and managing pipelines programmatically. Use Pipedream to connect Pipefy with hundreds of other apps and orchestrate workflows that can save time, reduce errors, and enhance efficiency.

Action Code

import pipefy from "../../pipefy.app.mjs";
import constants from "../common/constants.mjs";

export default {
  key: "pipefy-create-pipe",
  name: "Create Pipe",
  description: "Creates a pipe. [See the docs here](https://api-docs.pipefy.com/reference/mutations/createPipe/)",
  version: "0.3.2",
  type: "action",
  props: {
    pipefy,
    organization: {
      propDefinition: [
        pipefy,
        "organization",
      ],
    },
    name: {
      type: "string",
      label: "Name",
      description: "Name of the new Pipe",
    },
    phases: {
      type: "string[]",
      label: "Phase Names",
      description: "Names of the new Pipe's phases",
      reloadProps: true,
    },
    members: {
      propDefinition: [
        pipefy,
        "members",
        (c) => ({
          orgId: c.organization,
        }),
      ],
      withLabel: true,
      reloadProps: true,
    },
    icon: {
      type: "string",
      label: "Icon",
      description: "The Pipe icon",
      options: constants.ICON_OPTIONS,
      optional: true,
    },
  },
  async additionalProps() {
    const props = {};
    if (this.phases?.length > 0) {
      for (const phase of this.phases) {
        props[phase] = {
          type: "boolean",
          label: `${phase} Done?`,
          description: `Is ${phase} a final/done phase?`,
          default: false,
        };
      }
    }
    if (this.members?.length > 0) {
      for (const member of this.members) {
        props[member.value] = {
          type: "string",
          label: `Role for ${member.label}`,
          description: "The user role name",
          options: constants.ROLE_OPTIONS,
        };
      }
    }
    return props;
  },
  async run({ $ }) {
  /*
  Example query:

  mutation createNewPipe{
    createPipe(
        input: {name: "UsersPipe", organization_id: 300455771 } ) {
            pipe{id name}
      }
  }
  */

    const variables = {
      name: this.name,
      organizationId: this.organization,
      icon: this.icon,
    };

    if (this.phases?.length > 0) {
      const phases = [];
      for (const phase of this.phases) {
        phases.push({
          name: phase,
          done: this[phase],
        });
      }
      variables.phases = phases;
    }

    if (this.members?.length > 0) {
      const members = [];
      for (const member of this.members) {
        members.push({
          role_name: this[member.value],
          user_id: member.value,
        });
      }
      variables.members = members;
    }

    const response = await this.pipefy.createPipe(variables);
    $.export("$summary", "Successfully created pipe");
    return response;
  },
};

Action Configuration

This component may be configured based on the props defined in the component code. Pipedream automatically prompts for input values in the UI.

LabelPropTypeDescription
PipefypipefyappThis component uses the Pipefy app.
OrganizationorganizationstringSelect a value from the drop down menu.
Namenamestring

Name of the new Pipe

Phase Namesphasesstring[]

Names of the new Pipe's phases

Membersmembersstring[]Select a value from the drop down menu.
IconiconstringSelect a value from the drop down menu:airplaneataxebadgebagboatbriefingbugbullhorncalendarcartcatchart-zoomchart2chatcheckchecklistcompasscontractdogeiffelemofinish-flagflameframefroggamegithubglobegrowthhr-processhr-requestsicejuicelamplemonadelibertylikemacmagicmapmessagemkt-requestsmoneyonboardingpacmanpacman1payablephonepipefypizzaplanetplugreceivablesreceiverecruitment-requestsreloadrocketsalesskullsnow-flakestartargettasktask-managementtrophyunderwear

Action Authentication

Pipefy uses API keys for authentication. When you connect your Pipefy account, Pipedream securely stores the keys so you can easily authenticate to Pipefy APIs in both code and no-code steps.

To authorize requests to the Pipefy API, you'll need to generate a Personal access token. In order to create Pipefy triggers in Pipedream, you will need to be a Pipefy administrator.

About Pipefy

Process Management, Workflow Management Software

More Ways to Connect Pipefy + Mailgun

Create Card with Pipefy API on New Bounce from Mailgun API
Mailgun + Pipefy
 
Try it
Create Table Record with Pipefy API on New Bounce from Mailgun API
Mailgun + Pipefy
 
Try it
Delete Card with Pipefy API on New Bounce from Mailgun API
Mailgun + Pipefy
 
Try it
Get All Cards with Pipefy API on New Bounce from Mailgun API
Mailgun + Pipefy
 
Try it
Get Current User with Pipefy API on New Bounce from Mailgun API
Mailgun + Pipefy
 
Try it
New Bounce (Instant) from the Mailgun API

Emit new event when the email recipient could not be reached.

 
Try it
New Click (Instant) from the Mailgun API

Emit new event when the email recipient clicked on a link in the email. Open tracking must be enabled in the Mailgun control panel, and the CNAME record must be pointing to mailgun.org. See more at the Mailgun User's Manual Tracking Messages section

 
Try it
New Complaint (Instant) from the Mailgun API

Emit new event when the email recipient clicked on the spam complaint button within their email client. Feedback loops enable the notification to be received by Mailgun.

 
Try it
New Delivery (Instant) from the Mailgun API

Emit new event when an email is sent and accepted by the recipient email server.

 
Try it
New Delivery Failure (Instant) from the Mailgun API

Emit new event when an email can't be delivered to the recipient email server.

 
Try it
Create Mailing List Member with the Mailgun API

Add to an existing mailing list. See the docs here

 
Try it
Create Route with the Mailgun API

Create a new route. See the docs here

 
Try it
Delete Mailing List Member with the Mailgun API

Delete a mailing list member by address. See the docs here

 
Try it
Get Mailing List Member with the Mailgun API

Retrieve a mailing list member by address. See the docs here

 
Try it
Get Mailing List Members with the Mailgun API

List all mailing list members. See the docs here

 
Try it

Explore Other Apps

1
-
24
of
2,000+
apps by most popular

HTTP / Webhook
HTTP / Webhook
Get a unique URL where you can send HTTP or webhook requests
Node
Node
Anything you can do with Node.js, you can do in a Pipedream workflow. This includes using most of npm's 400,000+ packages.
Python
Python
Anything you can do in Python can be done in a Pipedream Workflow. This includes using any of the 350,000+ PyPi packages available in your Python powered workflows.
OpenAI (ChatGPT)
OpenAI (ChatGPT)
OpenAI is an AI research and deployment company with the mission to ensure that artificial general intelligence benefits all of humanity. They are the makers of popular models like ChatGPT, DALL-E, and Whisper.
Salesforce (REST API)
Salesforce (REST API)
Web services API for interacting with Salesforce
HubSpot
HubSpot
HubSpot's CRM platform contains the marketing, sales, service, operations, and website-building software you need to grow your business.
Zoho CRM
Zoho CRM
Zoho CRM is an online Sales CRM software that manages your sales, marketing, and support in one CRM platform.
Stripe
Stripe
Stripe powers online and in-person payment processing and financial solutions for businesses of all sizes.
Shopify Developer App
Shopify Developer App
Shopify is a user-friendly e-commerce platform that helps small businesses build an online store and sell online through one streamlined dashboard.
WooCommerce
WooCommerce
WooCommerce is the open-source ecommerce platform for WordPress.
Snowflake
Snowflake
A data warehouse built for the cloud
MongoDB
MongoDB
MongoDB is an open source NoSQL database management program.
Supabase
Supabase
Supabase is an open source Firebase alternative.
MySQL
MySQL
MySQL is an open-source relational database management system.
PostgreSQL
PostgreSQL
PostgreSQL is a free and open-source relational database management system emphasizing extensibility and SQL compliance.
AWS
AWS
Amazon Web Services (AWS) offers reliable, scalable, and inexpensive cloud computing services.
Twilio SendGrid
Twilio SendGrid
Send marketing and transactional email through the Twilio SendGrid platform with the Email API, proprietary mail transfer agent, and infrastructure for scalable delivery.
Amazon SES
Amazon SES
Amazon SES is a cloud-based email service provider that can integrate into any application for high volume email automation
Klaviyo
Klaviyo
Email Marketing and SMS Marketing Platform
Zendesk
Zendesk
Zendesk is award-winning customer service software trusted by 200K+ customers. Make customers happy via text, mobile, phone, email, live chat, social media.
ServiceNow
ServiceNow
The smarter way to workflow
Notion
Notion
Notion is a new tool that blends your everyday work apps into one. It's the all-in-one workspace for you and your team.
Slack
Slack
Slack is a channel-based messaging platform. With Slack, people can work together more effectively, connect all their software tools and services, and find the information they need to do their best work — all within a secure, enterprise-grade environment.
Microsoft Teams
Microsoft Teams
Microsoft Teams has communities, events, chats, channels, meetings, storage, tasks, and calendars in one place.